asmdylink.0`````````~```~~``~`~`~````` ` `~~`~~~~`~~~~`~~~~Henvmemoryenv__indirect_function_tablepenv__stack_pointerenv __memory_baseenv __table_baseenv__hwjs_frame_allocenv__hwjs_frame_publishenv__hwjs_set_parkedenviswalnumenviswgraphenviswspaceenviswdigitenviswcntrlenviswprintenvwcwidthenv__hwjs_drive_abienv__hwjs_promise_i32env__hwjs_budget_not_refilledenv__hwjs_promise_i64env__hwjs_promise_a16env__hwjs_register_suspendsenv__hwjs_register_capsummaryenv__hwjs_register_fpcast_adapterenv__hwjs_budget_setenv __hwjs_budgetenv__hwjs_budget_getenv__hwjs_budget_uninitialized env__hwjs_clear_parked envmemcpyenv__hwjs_take_parkedenv__hwjs_xfer_descendenv hwjs_lj_matchenvhwjs_lj_unwoundenv hwjs_destroyenv__hwjs_xfer_returnenv__hwjs_frame_freeenv hwjs_trap envreallocenvmemsetenv__hwjs_xfer_parkenv__hwjs_xmod_dispatch_checkenvwcschrenvwcrtombenvwctombenvfputcenvtgotoenvtputsenvfputsenv __assert_fail env__hwjs_noreturn_completedenvfflushenvcallocenvfreeenvwcslenenvmbstowcsenvmallocenvabort envfprintfenv tcgetattrenv__errno_locationenv cfgetispeedenv cfgetospeedenv cfsetispeedenv cfsetospeedenv tcsetattrenvwcsncpyenvwcsstrenvregcompenvregexecenvregfreeenvwcsncmpenvwmemcpyenvstrlcpyenvstrncmpenvstrcmpenvffsenvstrlenenvstrcpyenv__isoc23_strtolenv __ctype_b_locenvmbrtowcenv mbsrtowcsenv__ctype_get_mb_cur_maxenv__ctype_tolower_locenvfilenoenvfchmodenvftellenvwcscmpenvfopenenv __getdelimenvfcloseenv__isoc23_wcstolenvtgetstrenvwcstombsenv sigemptysetenv sigaddsetenv sigprocmaskenvgetenvenvtgetentenvtgetflagenvtgetnumenvioctlenvstrchrenvwcscspnenvmkstempenvwriteenvforkenvcloseenvexeclpenvexitenvunlinkenvwaitpidenvlseek envreadenviswupperenvtowlowerenviswlowerenvtowupperenvwctobenviswalphaenvisattyenv sigactionenvkillenvfcntlenv secure_getenvenvsnprintfenvstrdupenvgetuidenv getpwuid_renv getpwnam_renvstrrchrenvclosedirenvopendirenvreaddirenv strcasecmpenvstatenvqsort envgetcenvmemmoveenvhwjs_sj_record env hwjs_lj_clear env hwjs_lj_valueenvstrstrenvgetpwuidenvfdopenenvfreadenvferrorenvfwriteenvfseeko envftelloenv ftruncateenvsetpwent envgetpwentenvendpwent envhwjs_lj_arm_fromenvstrcollenv vsnprintfGOT.funcmemcpyGOT.funcreallocGOT.funcmemsetGOT.funcwcschrGOT.funccallocGOT.funcfreeGOT.func el_winsertstrGOT.funcwcslenGOT.func el_deletestrGOT.func el_deletestr1GOT.funcel_wreplacestrGOT.funcel_wgetcGOT.funcwcsncpyGOT.funcwcsncmpGOT.funcel_initGOT.funcct_decode_stringGOT.funcwcsdupGOT.funcel_endGOT.func el_init_fdGOT.funcel_resetGOT.func el_sourceGOT.func secure_getenvGOT.funcstrlenGOT.funcsnprintfGOT.funcfopenGOT.funcfcloseGOT.func __getdelimGOT.func el_resizeGOT.funcel_beepGOT.funcwcscmpGOT.funcfprintfGOT.funcel_getcGOT.funcwctobGOT.funcel_pushGOT.funcel_wpushGOT.funcel_getsGOT.funcel_wgetsGOT.funcct_encode_stringGOT.funcel_parseGOT.func el_wparseGOT.funcel_lineGOT.func el_insertstrGOT.func el_replacestrGOT.func__isoc23_wcstolGOT.func history_wGOT.funcstrvisGOT.funcabortGOT.funcmallocGOT.funcwcstombsGOT.funcwcrtombGOT.funcwctombGOT.funcmbstowcsGOT.func tok_winitGOT.functok_wstrGOT.functok_wendGOT.funcreadGOT.funcfcntlGOT.funcel_wsetGOT.funcmbrtowcGOT.funcwcsstrGOT.funcregcompGOT.funcregexecGOT.funcregfreeGOT.funcstrchrGOT.func sigactionGOT.funckillGOT.funcgetenvGOT.funcstrcmpGOT.functgetentGOT.functgetflagGOT.functgetnumGOT.funcioctlGOT.functgetstrGOT.funcstrcpyGOT.functgotoGOT.functputsGOT.funcfputsGOT.funcfputcGOT.funcfflushGOT.funcstrlcpyGOT.func__isoc23_strtolGOT.funcisattyGOT.func tcgetattrGOT.func tcsetattrGOT.funcstrncmpGOT.func __assert_failGOT.funcwcscspnGOT.funcmkstempGOT.funcwriteGOT.funcforkGOT.funccloseGOT.funcexeclpGOT.funcexitGOT.funcunlinkGOT.funcwaitpidGOT.funclseekGOT.func reallocarrGOT.func tok_wlineGOT.functok_initGOT.funcstrdupGOT.functok_endGOT.functok_lineGOT.functok_strGOT.func history_winitGOT.func history_wendGOT.funcfchmodGOT.funcftellGOT.func history_initGOT.func history_endGOT.funcfn_tilde_expandGOT.func getpwuid_rGOT.func getpwnam_rGOT.funcfn_filename_completion_functionGOT.funcstrrchrGOT.funcclosedirGOT.funcopendirGOT.funcreaddirGOT.funccompletion_matchesGOT.funcfn_display_match_listGOT.funcqsortGOT.funcstatGOT.func strcasecmpGOT.func fn_complete2GOT.memstdinGOT.funcgetcGOT.func fn_completeGOT.func_el_fn_completeGOT.func_el_fn_sh_completeGOT.funcrl_prep_terminalGOT.funcel_setGOT.funcrl_deprep_terminalGOT.func rl_set_promptGOT.mem rl_promptGOT.funcmemmoveGOT.funcrl_save_promptGOT.memrl_prompt_savedGOT.func rl_initializeGOT.memrl_readline_stateGOT.mem rl_instreamGOT.mem rl_outstreamGOT.memstdoutGOT.memrl_readline_nameGOT.memstderrGOT.funchistoryGOT.memmax_input_historyGOT.memhistory_lengthGOT.memrl_line_bufferGOT.memrl_getc_functionGOT.memrl_catch_signalsGOT.memrl_terminal_nameGOT.funcel_getGOT.memrl_pointGOT.memrl_endGOT.memrl_already_promptedGOT.func rl_completeGOT.memrl_inhibit_completionGOT.memrl_completion_word_break_hookGOT.memrl_basic_word_break_charactersGOT.memrl_completion_entry_functionGOT.mem rl_attempted_completion_functionGOT.memrl_completion_query_itemsGOT.memrl_attempted_completion_overGOT.memrl_completion_typeGOT.memrl_completion_append_characterGOT.funcreadlineGOT.memrl_startup_hookGOT.memrl_doneGOT.memrl_pre_input_hookGOT.mem rl_event_hookGOT.func using_historyGOT.memhistory_offsetGOT.funcget_history_eventGOT.memhistory_expansion_charGOT.funchistory_searchGOT.mem history_baseGOT.func history_getGOT.funcstrstrGOT.funchistory_search_prefixGOT.funchistory_expandGOT.memhistory_subst_charGOT.mem"history_inhibit_expansion_functionGOT.memhistory_no_expand_charsGOT.funchistory_arg_extractGOT.funchistory_tokenizeGOT.func add_historyGOT.funcstifle_historyGOT.funcremove_historyGOT.funcunstifle_historyGOT.funchistory_truncate_fileGOT.funcgetpwuidGOT.funcfdopenGOT.funcfreadGOT.funcferrorGOT.funcfwriteGOT.funcfseekoGOT.funcftelloGOT.func ftruncateGOT.func read_historyGOT.func write_historyGOT.funcappend_historyGOT.funcreplace_history_entryGOT.func clear_historyGOT.func history_listGOT.funccurrent_historyGOT.funchistory_total_bytesGOT.funcprevious_historyGOT.func next_historyGOT.funchistory_search_posGOT.func tilde_expandGOT.funcfilename_completion_functionGOT.funcusername_completion_functionGOT.funcsetpwentGOT.funcgetpwentGOT.funcendpwentGOT.funcrl_display_match_listGOT.func rl_bind_keyGOT.func rl_insertGOT.func rl_read_keyGOT.funcrl_reset_terminalGOT.funcrl_insert_textGOT.func rl_newlineGOT.func rl_add_defunGOT.funcvisGOT.funcrl_callback_read_charGOT.mem rl_linefuncGOT.funcrl_callback_handler_installGOT.funcrl_callback_handler_removeGOT.func rl_redisplayGOT.funcrl_forced_update_displayGOT.funcrl_get_previous_historyGOT.funcrl_read_init_fileGOT.funcrl_parse_and_bindGOT.funcrl_variable_bindGOT.func rl_stuff_charGOT.func rl_copy_textGOT.funcrl_replace_lineGOT.funcrl_delete_textGOT.funcrl_get_screen_sizeGOT.funcrl_set_screen_sizeGOT.funcrl_completion_matchesGOT.funcrl_filename_completion_functionGOT.func_rl_abort_internalGOT.func_rl_qsort_string_compareGOT.funcstrcollGOT.funchistory_get_history_stateGOT.funcrl_resize_terminalGOT.funcrl_reset_after_signalGOT.memrl_prep_term_functionGOT.funcrl_echo_signal_charGOT.funcrl_crlfGOT.funcrl_dingGOT.funcsvisGOT.func mbsrtowcsGOT.funcsnvisGOT.funcstrsvisGOT.funcstrsnvisGOT.funcstrsvisxGOT.func strsnvisxGOT.func strsenvisxGOT.funcnvisGOT.funcstrnvisGOT.funcstravisGOT.funcstrvisxGOT.funcstrnvisxGOT.func strenvisxGOT.funcunvisGOT.func strnunvisxGOT.func strunvisxGOT.funcstrunvisGOT.func strnunvisGOT.funcel_wgetGOT.func rl_messageGOT.func vsnprintfGOT.mem__hwjs_module_id                                 BA A A A A A A A A A A A A A A A A A A A A Aԍ A AЍ A؍ A Ač A A A A A܍ A A A A A A A A A A Aȍ A̍ A A A A A A A A A A A A A A A A A A A A A A $__wasm_call_ctors el_winsertstr el_deletestr el_deletestr1el_wreplacestr el_cursorel_initel_end el_init_fdel_resetel_wline el_source el_resizeel_beepel_getcel_pushel_getsel_parseel_line el_insertstr el_replacestrct_encode_stringct_decode_string el_wparseel_wpushel_wgetcel_wgets reallocarrwcsdup tok_winit tok_wresettok_wend tok_wlinetok_wstrtok_init tok_resettok_endtok_linetok_str history_winit history_wend history_init history_endfn_tilde_expandfn_filename_completion_functioncompletion_matchesfn_display_match_list fn_complete2 fn_complete_el_fn_complete_el_fn_sh_completerl_prep_terminalrl_deprep_terminal rl_set_promptrl_save_promptrl_restore_promptrl_prompt_saved rl_prompt rl_initializerl_already_prompted rl_completerl_completion_append_characterreadline using_historyget_history_event history_gethistory_searchhistory_search_prefixhistory_expandhistory_arg_extracthistory_tokenize add_historystifle_historyremove_historyunstifle_historyhistory_is_stifledmax_input_historyhistory_truncate_file read_history write_historyappend_historyreplace_history_entry clear_history where_historyhistory_offset history_listcurrent_historyhistory_total_byteshistory_set_poshistory_lengthprevious_history next_historyhistory_search_pos tilde_expandfilename_completion_functionusername_completion_functionrl_display_match_list rl_bind_key rl_insert rl_read_keyrl_reset_terminalrl_insert_text rl_newline rl_add_defunrl_callback_read_charrl_callback_handler_installrl_callback_handler_remove rl_redisplay rl_forced_update_display rl_get_previous_history rl_read_init_file rl_parse_and_bind rl_variable_bind rl_stuff_char rl_copy_text rl_replace_line rl_delete_text rl_get_screen_size rl_set_screen_size rl_completion_matches rl_filename_completion_function _rl_abort_internal _rl_qsort_string_compare history_get_history_state rl_kill_text rl_make_bare_keymap rl_get_keymap rl_set_keymap rl_generic_bind rl_bind_key_in_map rl_set_key rl_cleanup_after_signal rl_on_new_line rl_free_line_state rl_set_keyboard_input_timeout rl_resize_terminal rl_reset_after_signal rl_echo_signal_char rl_crlf rl_ding rl_abort rl_set_keymap_name free_history_entry _rl_erase_entire_line svis snvis strsvis strsnvis strsvisx strsnvisx strsenvisx vis nvis strvis strnvis stravis strvisx strnvisx strenvisx unvis strnunvisx strunvisx strunvis strnunvis el_wset el_wget el_set el_get history_w history rl_message __hwjs_drive_abi __hwjs_promise_i32 __hwjs_budget_not_refilled __hwjs_promise_i64 __hwjs_promise_a16 __hwjs_register_suspends __hwjs_register_capsummary __hwjs_module_id__hwjs_register_fpcast_adapter __hwjs_budget_set __hwjs_budget__hwjs_budget_get __hwjs_budget_uninitialized rl_instreamrl_getc_functionrl_readline_state rl_outstreamrl_readline_namerl_line_bufferrl_catch_signalsrl_terminal_namerl_pointrl_endrl_inhibit_completionrl_completion_word_break_hookrl_basic_word_break_charactersrl_completion_entry_function rl_attempted_completion_functionrl_completion_query_itemsrl_attempted_completion_overrl_completion_type rl_event_hookrl_startup_hookrl_donerl_pre_input_hook history_basehistory_expansion_charhistory_subst_char"history_inhibit_expansion_functionhistory_no_expand_chars rl_linefuncrl_prep_term_functionrl_library_versionrl_readline_versionrl_catch_sigwinch"rl_completer_word_break_charactersrl_completer_quote_charactersrl_basic_quote_charactersrl_startup1_hookrl_filename_completion_desiredrl_ignore_completion_duplicatesreadline_echoing_p"_rl_print_completions_horizontallyrl_redisplay_function"rl_completion_display_matches_hookrl_deprep_term_functionrl_special_prefixesemacs_standard_keymapemacs_meta_keymapemacs_ctlx_keymap_rl_complete_mark_directoriesrl_directory_completion_hookrl_completion_suppress_appendrl_sort_completion_matches$_rl_completion_prefix_display_length _rl_echoing_phistory_max_entriesrl_display_promptrl_erase_empty_line__wasm_apply_data_relocs #              %     pA#j#A5j6A#j#A6j6A#j#A7j6A#j#A8j6A#j#A:j6A#j#A:j6A#j#A;j6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6AĔ#j#Aj6A#j#Aj6A#j#Aj6A̕#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6AĚ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6AԜ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A̝#j#Aj6Aܝ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6AĞ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A̟#j#Aj6A#j#Aj6A#j#Aj6AȠ#j#Aj6Aؠ#j#Aj6A#j#Aj6A#j#Aj6AС#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6AĤ#j#Aj6A#j#Aj6Aĥ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Aī#j#Aj6Aܫ#j#Aj6A#j#Aj6A#j#Aj6AЭ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Aܯ#j#Aj6A#j#Aj6A̰#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A̴#j#Aj6A#j#Aj6Aȶ#j#Aj6Aض#j#Aj6A#j#Aj6A#j#Aj6Aܷ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Aл#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Aп#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6À#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Aȁ#j#Aj6A܁#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Â#j#Aj6A܂#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Ā#j#Aj6A؄#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Aȅ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Ać#j#Aj6A؇#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6AĈ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A؉#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6AȊ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6Aԋ#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6A#j#Aj6 #Aj!@@@ AAH A#jAAA#jAAA#jAAA#jAA< A A  AB   UA" 6 #"Aj6  Aj6  A:  Aj  @@@@@ - (" (< (4"k"Au6  (8 kAu6 (!    #A"6 E    A:  @@ Aj (   @@ Aj (   (  A!@ ("(HE (L!  6  (6  (6  -U:  (X6  A6      #Aj cA" 6 #"Aj6  Aj6  6  6  A:  Aj  @@@@@ - (! ( ! ((!   At #A"6 E    A:  @@ Aj (  @@ Aj (  ( (" ( (Atj6  A6      #Aj \A$" 6 #"Aj6  Aj6  6  A:  Aj  @@@@@@@@@@@@@ -  ("(<" ( "Atj (@I A" 6 #"Aj6  Aj6  6  A:X  Aj" A"6 E    A: @@ Aj (  @@ Aj (  ("(!  E ((?@ABCDEFGHIJKLNPQ1 @@ AjT (  0 (! (  B7A"A6 #"Aփj6  A׃j6  6  A:!  A؃j" A"60   A:  @@ AjS (0 / (! (0 A  #AjA"64   A:  @@ AjR (4 . (! (4 B7@ (8 (<"I @ ("( (G AA|  (4Fj!  68 (! A #AjA"68   A:  A!@@ AjQ (8 - (! (8A! (4" ( (  ( l @@ Aj= (  (! (! ( (! (! (! (! F #! (! (!A," A߃j6  Aj6  6 A  kAu  kAH"   kAuk6  A:(  AჀj" A"6   A:  @@ Aj< (  (! (! (! (! (! (#!A" A܃j6  A݃j6    kAH" 6$  6   kAu6(  A:!  Aރj" A"6   A:  @@ Aj; Aj!  (  Aj!  #! (!A" A܃j6  A݃j6    kAH"6$  6   kAu6(  A:!  Aރj" A"6   A:  @@ Aj9 (  (! (! (! (! (! (! (! (! (! (! (! (#!A4" A⃀j6  Aダj6  6 A  kAu kAH"    kAuk" Au" s k" kAu  kAuk" J"  K6  A:!  A䃀j" A"6   A:  @@ Aj8 Aj!  (  Aj! ( c @@ Aj6 (  Aj Aj ( (kAH(! (! ( (! (! (! (!  F  kAH" ("kAu (   (kAuk"AH ` (! A" 6$ #"Aكj6  Aڃj6  6  6  A:!  Aۃj" A"6   A: } @@ Aj5 (  Aj Aj ( ("kAH" (! (! (! (! (! (! ( (`"6 kAu    kAuk"   k" Auk"  H"6 AH _ At" At"kA|j H ] (! ( j" A|j" A kj"(6 A|j"! I ] Axj!"A! T @@ Aj4 (  (! (! (! (! (    kAHF a (" Aj Aj ( ("kAH"( kAu (   ("kAu"#kAt"j"$("%E a  j!&A! R #! (! (!A" A܃j6  A݃j6  6$  6  kAH kAu6(  A:!  Aރj" A"6   A: z @@ Aj2 (  (! ( ("'E _ AA ( (kAHj( ("(kAu!) (!*A! O @@ Aj1 ( (! (! ( (" ( (" (kAH" !  F  kAu"A ( kAu " F  (! A"  k6$ #"Aكj6  Aڃj6  6  6  A:!  Aۃj" A"6   A: x @@ Aj0 ( ( #! (! (! (! (! (! (!A" A܃j6  A݃j6  6 A kAu kAH" " 6(   "  kAv kAtj6$  A:!  Aރj" A"6   A: v @@ Aj. ( ( \ (! A" kAu6( #"A܃j6  A݃j6  6$  6  A:!  Aރj" A"6   A : t @@ Aj, (  ( Z @@ Aj+ (  (! (A"A6 #"Aփj6  A׃j6  6  A:!  A؃j" A"6   A": r @@ Aj* (  (! (! ( (( Atj(!#! ! A"6 E    A#: q @@ Aj) (  @@ Aj) (  ("(!  (!A4" 6 #"A⃀j6  Aダj6  6  A:!  A䃀j" A"6   A$: o @@ Aj' (  (! (! ( (( Atj(A6  (H  ((! h @@ Aj& (  (! (t! (   #A؃jA"6   A&: m @@ Aj% (  (  A6 l   (!A" 6 #"A僀j6  A惀j6  A:  A烀j" A"6   A: j # $#A‘j #"E Aj$ H # G#A‘j # &#A‘j # &#A‘j # +#A‘j # +#A‘j # +#A‘j # +#A‘j # +#A‘j # !#A‘j # !#A‘j # !#A‘j # 1#A‘j # .#A‘j # .#A‘j # +#A‘j # '#A‘j # $#A‘j # $#A‘j # !#A‘j # $#A‘j # $#A‘j # #A‘j # #A‘j # #A‘j # #A‘j #"E  Aj$ - # ,#A‘j  A: L # 9#A‘j # #A‘j # #A‘j    A): G  A: F A! # A! " A! ! A! A! 5 A! 6 A! 5 A! 4 A! 3 A! 2 A! 1 A! 0 A ! / A! / A! 3 A! 2 A! 3 A! 2 A!  A!  A! A! A! A!  A!  A!  A!  A! @@@@@  (6 )6 *6 * '6 )AF #"E  Aj$A!  ("("'E  Aj!( (Aj!) (Aj!*   A4: + A! @@@@@  $6 #6 &6 & %6 #AF #"E  Aj$A!  ("("%E  Aj!$ (Aj!# (Aj!&   A6: * A! @@@@@  "6 !6#"E  Aj$A!  (! (" ("(6 A|j"! I A|j!"   A7: ) A! @@@@@  6 6 6  6@ AG Aj Aj ( ("kAH"( (kAu (   (kAuk!  #"E  Aj$A!  @ ("(" Aj Aj ( ("kAH"( (kAu (   (kAuk!  Aj! (Aj! (Aj!   A=: ( A! @@@@@  6 6#"E  Aj$A!  (! (! ( ("(6 Aj"  AtjO  (Aj!   A<: ' A! @@@@@  6 6 6  6 AF #"E  Aj$A!  ("("E  Aj! (Aj! (Aj!   A8: & A! @@@@@  6 6 6  6@ AG Aj Aj ( ("kAH"( (kAu (   (kAuk! #"E  Aj$A!  @ ("(" Aj Aj ( ("kAH"( (kAu (   (kAuk! Aj! (Aj! (Aj!   A:: % A! @@@@@  6 6#"E  Aj$A!  (! (" ("(6 A|j" I  A|j!   A;: $ A! @@@@@@@@@@@@@@@@@@@  6<@  ("(8G (! (! (! AH A   j ((`J"!  j! 6@ 6D@@@ ("Awj$ @ AJ   E  (! A<"A6 #"Aj6  Aj6  6  6  A:8  Aj" A"6`   A: 5 ("(6LA! (,"6P  (Atj( (AtjA6 AH  !@ Aq  ("(Atj( (Atj Aj"AtjA6 AF   A "6d AH A! @ (:   A?:  A: A!  A! @@@@@  6 6 A|j" ( A|j"(G #"E  Aj$A!  (A|j! (A|j" (M   (K    A,: A! ((" L   J  6 (!A" 6 #"A胀j6  A郀j6  6  A:!  Aꃀj" A"6   A!:  (p! (" 6A" 6 #"A胀j6  A郀j6  6  A:!  Aꃀj" A"6   A%:  6 6 Aj! Aj!@ ( ! !  ! ! (" O A! @@@@@@@@@@@@  6 6 6 6 6 (" (G  (!  (AjO   (AjO  ( G   ("Aj! (" Aj! ( (G  6 6@  (O  (I  Aj! Aj! @@ (" (" k  ("k" N Au  (kAuJ  (! (!  (! ! ! 6 6 6 6 ( (I   #"E  Aj$A!  #"E  Aj$A!  (Aj! (! (! (! (!   A-:   A.:  A! (("6 E  (" (AjO A! @@@@@@@@@@@@  6 6 6 6 6 (" (G  (! (AjO   (AjO   (G   ("Aj! ("Aj! ( (G  6 6@ (O  (I  Aj! Aj! @@ (" (" k ("k" N Au  (kAuJ  (! (!  (! ! ! 6 6 6 6 ( (I   #"E  Aj$A!  #"E  Aj$A!  (Aj! (! (! (! (!   A/:   A0:  A! (" (Aj (" (Aj" kAH" " kAu  " kAuk! (" kAu ("kAuk!@ ("(h"Aq @ AH ! ! ! !    AJ" "  " k  kH" !  ! @ Aq @ AJ ! ! ! !    AH" "  " k  kJ" !  ! 6 6 6 6 6 6 (!A" 6 #"A胀j6  A郀j6  6  A:!  Aꃀj" A"6   A : #Àj UA$" 6 #"AЀj6  Aрj6  A:  AҀj  @@@@@@@@@@@@@ -  @@ Aj (   (! ( A8"A 6$ #"Aj6  Aj6  6  A:!  Aj" A"6 E    A: @@ Aj (  @@ Aj (  ( ("B7 A! (dAH  ((("6 (A6 (dAJ   @@ Aj (  (  A6    ("(!A" 6 #"A胀j6  A郀j6  6  A:!  Aꃀj" A"6   A:  # #Aj   A!  A! @@@@@  6#"E  Aj$A!  (! ( ("Atj(A6 Aj" (dN    A:  A! ("A6A" 6 #"Aj6  Aj6  A:  Aj" A"6   A: #AҀj UA" 6 #"Aj6  Aj6  A:  Aj  @@@@@@ - ("B7 A! (dAH  ((("6 (A6 (dAJ   # #Aj A!  A! @@@@@  6#"E  Aj$A!  (! ( ("Atj(A6 Aj" (dN    A:  A! (A6  A6 #Aj UA0" 6 #"Aj6  Aj6  A:,  Aj  @@@@@@@@@@@ -, @ ("(8" (<"I !@ ( (G AA|  (4Fj!  68 ("(! (! (`6 (4" O A!  @@ Aj (   (! (! ( A" 6 #"Aփj6  A׃j6  6  A:!  A؃j" A"6$   A:,  @@ Aj ($  (! ($A" 6 #"Aj6  Aj6  A:  Aj" A"6(   A:,  @@ Aj ((  ((  A6    # #Aj   A! @@@@@@@  6@@@@ ("Awj @@ AJ    ( !A!A  ("AJ  j Jq"!  j! ("Awj  Axrk!  Aj!A!  @ AJ A!   @ E !  AA AJ!  (Aj! ( (" ( "N"j!  A k!  A!  j! 6 6@ Aj" ("(8I   ( "N"j!  A k! ( @@ Ayj  ($!A!A!A! ? ("6H ("6L AI 9 Aj!A! 4 @@ Aj* (P  @@ Aj* (P  (P"(!  9 @@ Aj) (\  (\ : @@ Aj( (`  (` : @@ Aj' (h  @@ Aj' (h  (h"(! A! 0 @@ Aj& (l  (l 8 #AȌj" 6   #A"6p   A : ` @@ Aj$ (p  (p ($!A!A!A! 6 @@ Aj" (  @@ Aj" (  ("-!  : @@ Aj! (  @@ Aj! (  ( : @@ Aj  (  @@ Aj  (  ("(!  E  > @@ Aj ( @@ Aj ( ("(!   > ((  ? @@ Aj ( @@ Aj Aj!  ( Aj!  @@ Aj ( @@ Aj Aj!  ( Aj! ("-!  > @@ Aj ( @@ Aj ( ("(!   A (A|j ((4O B @@ Aj (  @@ Aj (  ("(!   B (( C @@ Aj (  (! (! (  (F  (" (6A" 6 #"Aj6  Aj6  A:h  Aj" A"6 E    A: T @@ Aj (  @@ Aj (  ("-!  A! AqAF J ( (68A! B @@ Aj (  @@ Aj (  ("(!  C @@ Aj (  @@ Aj (  ("-!  E @@ Aj (  A! ( F   ( Atj 6  Aj6  (<"Aj6<  ( 6 A6A" 6 #"Aʀj6  Aˀj6  A:  Àj" A"6@   A: L # #A󑀀j @#E A! E #A󑀀j #"E Aj$  # #A󑀀j #"E Aj$  # #A󑀀j (A|j ((4I *#"E Aj$  # #A󑀀j #"E Aj$  # #A󑀀j # #A󑀀j # #A󑀀j # #A󑀀j # #A󑀀j # #A󑀀j    A: ;  A: :  A: 9  A : 8 A! 2 A! 3 A!  A! A! A! @@@@@@@  6d#! (!#À! Aݠj ! A"6h E    A : 7 @@ (dAj (H (LAtjI  (!A," 6 #"Aǀj6  AȀj6  A:!  Aɀj" A"6l   A : 7 #"E  Aj$A!  (dAj!   A#: 4 A!  A! (Aj" ((@I   (A|j!  (Aj" ((@I   (A|j!  (" (8 (LAtjAtj"68#! ( @@ Aj0 ( , @@ Aj0 ( , ("(!    ("(h!#! (!  AֈA Aqj60  A聀j A0jA! #A"6 E ;   A: < @@ Aj. ( * @@ Aj. Aj! ( ( ) Aj! ' #! (!#!  A؁jр! A"6 E    A : : @@ Aj, ( ( @@ Aj, ( ( ("(!    ("(! (!  6@ #Aׁj AjA! #A"6 E 7   A : 8 @@ Aj* ( & @@ Aj* Aj! $ ( % Aj! # #! (!#!  A؁jр! A"6 E    A : 6 @@ Aj( ( $ @@ Aj( ( $ ("(!  E #! (!#!  A؁jр! A"6 E    A : 4 @@ Aj& ( " @@ Aj& ( " ("(!    ("(! (x(!  6P #Aׁj AjA! #A"6 E 0   A : 1 @@ Aj# (  @@ Aj# Aj!  (  Aj!  #! (!#!  A؁jр! A"6 E    A: / @@ Aj! (  @@ Aj! (  ("(!  #!@ E Aj! A琀j!A! " ("(! (x( !  6` #Aׁj AjA! #A"6 E ,   A: - @@ Aj (  @@ Aj Aj!  (  Aj!  @@ Aj (  @@ Aj (  ("(! A!  @@ Aj (  @@ Aj (  ("(! A!  @@ Aj (  @@ Aj (  ("(!   @@ Aj (  @@ Aj (  ("(!   @@ Aj (  @@ Aj Aj!A!  (  Aj!A!  @@ Aj (  @@ Aj (  ( (Aj! (!A!  @@ Aj (  @@ Aj Aj!A!  (  Aj!A!  @@ Aj (  @@ Aj Aj!  (  Aj!  @@ Aj (  @@ Aj Aj!A!  (  Aj!A!  @@ Aj (  @@ Aj (  ("(!   @@ Aj (  @@ Aj Aj!A!  (  Aj!A!  @@ Aj (  @@ Aj Aj!A!  (  Aj!A! @@ Aj (  @@ Aj (  ("(!   @@ Aj ( @@ Aj Aj! ( Aj! @@ Aj ( @@ Aj ( (  @@ Aj ( @@ Aj Aj!A! ( Aj!A! @@ Aj ( @@ Aj ( ("(!   @@ Aj  ( @@ Aj  Aj!A!  (  Aj!A!  @@ Aj  (  @@ Aj  Aj!A!  (  Aj!A!  @@ Aj  (  @@ Aj  (  ("(!   @@ Aj  (  @@ Aj  Aj!A!  (  Aj!A!  @@ Aj  (  @@ Aj  Aj!A!  (  Aj!A!  @@ Aj (  @@ Aj (  ("(!   @@ Aj (  @@ Aj Aj!  (  Aj! A! (    # #Aҝj # #Aҝj   A!  A!  @@@@@@@@@@  6 6 (! ((!A" Aj6 #"Aj6  Aj6  6  A:d #" A"6 E    A:  (!#ǀ!  Ā! A"6 E    A:  (! E  ("6@  (! ((!#!  Aj郀! A"6 E   A:  #"E  Aj$A!  (Aj! (!  #! ((t  AjkAuj(!   A(:  A!  A!  A!  #̀!  Ajր! A"6 E   A: 6@@ E A! -"  A! -E  (( ! ((!  6p #Aj Aj #A"6 E    A: A! @@@@@@@@@@  6 6@ Aq"A%F     -! Aj!@@ A[jN        Aj!  -  (( !   6 #Aͭj Aj #A"6 E    A:  6 6 -:#"E  Aj$A!  (Aj! (! -!  @ (("E (E A! -E (( !  6 #Aj Aj #A"6 E   A:  #AԌj ((6#! (! A AjA! #πA"6 E   A: @@ (("E (  A! -E #! (( !  AjA #A"6 E   A: #!  A Հ! A"6 E   A: -  (( !  6 #Aj Aj #A"6 E    A:  A): A!  A! @@ (("E (  A! -E #! (( !  AjA #A"6 E    A:  #!  A Հ! A"6 E   A :  6@@ ( ( AJ  A! -E  (( ! ((!  6 #Aj Aj #A"6 E    A!:  @@ (("E (  A! -E #! (( !  AjA #A"6 E    A":  #!  A Հ! A"6 E   A#:  6@@ ( ( AJ  A! -E  (( ! ((!  6 #A䨀j Aj #A"6 E    A$:  @ (( "E (E A! -E  (( !  6 #Aj Aj #A"6 E    A%:  (! (!#΀!   ! A"6 E   A&:  #AԌj ((6#! (!   AjA! #πA"6 E    A':  @@ (( AJ  A! -E  (( ! ((!  6 #A䨀j Aj #A"6 E    A:  @ (("E (E A! -E  (( !  6 #Aj Aj #A"6 E    A:  (!#΀! A ! A"6 E   A:  #AԌj ((6#! A AjA! #πA"6 E   A:  6  A6 #Aj Aj$ WA0" 6 #"Aj6  Aj6  A:,  Aj   ~@@@@@@@@@@@@@@@@@@@@@@ -,  ( "A: A;#! Aj AjA #A"6 E    A:,  @@ Aj ( @@ Aj ( ( #! ( ! Aj AہjA #A"6 E    A:,  @@ Aj  (  @@ Aj  (  ( ( "("6 Aq @ -E A!  (!#Հ! 򀀀! A"6 E    A:,  @@ Aj  (  @@ Aj  (  ("(!   A! @@ Aj (   @@ Aj (   ( "(! A!  @@ Aj ($  @@ Aj ($  ($"(! A! @@ Aj ((  ( ! (( A: A!   # #Aj # #Aj   A! @@@@  ( "(!#ր!  Aj! A"6 E    A:,  A!@@@ AG (AG #"E  Aj$  ( " ("6  )"7  )"7  )"7  )"7  )" 7  )" 7  )" 7  7  7  7  7  7  7  7  6  (6  )7  )7  )7  )7  )7  )7  )7@ Aj"" ! (! ( " 6  (" A0qA0G6  ("A0qA0F6  ( (Asq (r6  (Asq (r6   (Asq (r6  ( (Asq (r6 Aq @ ( "-AqE Aj AjʅA!@@  j"Aj-" ( -" F Aj"- F  : @ AG A!@@  j"A2j-" ( " -F j : AF @ A3j-" ( " -F jAj : Aj! @ Aj-" ( -" F Aj"- F  : Aj! ( " -:  (6  -:  -:  /;  -:  -:  -:  -:  -:  -:  -:   A:,  A!  A! A! @@@@  ( "(!#׀! A Aj! A"6$ E    A:,  A! AG (AG @@#"E Aj$   A:,  A!  A! ( " ( (Asq (r6  ( (Asq (r6  ( (Asq (r6  ( (Asq (r6  -:  -:  -:  -:  -:  -:  -:  -:  -:  -:  -:  -:  -:  -:  -:  -:A"A6 #"Aj6  Aj6  6  A:D  Aj" A"6(   A:,  6  A6 #Aj   -:  -:  -:  -:  -:  -:  -!:  -:  -:  -:  -:  -:  -:  - :  -:  -: ]A" 6 #"Aj6  Aj6  6  A:D  Aj   Aj! Aj!@@@@@@@@@@ -D ("(6 A! A6 A6 (6$@@ (AG Aj! (!  Aj! 6( (6,#A܁j!A!A!  @@ Aj (4  (! (,! ( ! -F! (4  j  j-:A " 6 #"A؂j6  Aقj6  6  6  A:  Aڂj" A"68   A:D  @@ Aj (8  ((! (0! (! ( ! -E! (8  j  (jAj-: E  (! ($!A " 6 #"A؂j6  Aقj6  6  6  A:  Aڂj" A"6<   A:D  @@ Aj (<  (! ((! ($! -F! (<  j  j-:A " 6 #"A؂j6  Aقj6  6  6  A:  Aڂj" A"6@   A:D  @@ Aj (@  (0! (! ($! -E! (@  j  (jA j-: A!      @@@@  60 (" jAj-":E 6  (jAj-":F 6@ (  F  ( !A " 6 #"A؂j6  Aقj6  6  6  A:  Aڂj" A"64   A:D  (0"A j!@ ( "AG  A6  A!  A! #Aj \A" 6 #"Aj6  Aj6  6  A:  Aсj  @@@@@@@@ - ("-Aq  -E   @@@ Aj (  @@ Aj (  ("(! A!    # #Aj   A! @@@@  ( ! ("(!#׀!   Aj! A"6 E    A:  AG (AG @@#"E Aj$   A:  A!  A!  A6 #Aсj WA$" 6 #"Aƒj6  AÃj6  A:  Aꁀj   @@@@@@@@@@@@@@@@@@ -  A! ( "-AjAqAI  -Aq  @@ Aj (  @@ Aj (  ("(! A! @@ Aj (  ( ! (  -:  (6  -:  -:  /;  -:  -:  -:  -:  -:  -:  -: (! (!A!@@A A}jt" q ( j"A2j-" -F  : @  qE ( " j -: Aj"AG ( " -:  (6  -:  -:  /;  -:  -:  -:  -:  -:  -:  -: @@ Aj (  @@ Aj (  ("(! A!   # #Aj # #Aj # #Aj   A!  A! @@@@  ( "(!#ր!  Aj! A"6 E    A:  A!@@@ AG (AG #"E  Aj$  ( " (A0qA0F6@ Aj" ( Aj! ( " 6@ Aj"" ! @@  ("G @ ( Aj"" !  ("F  ( !    ( Aj" (  ( ( "("AqE @ (" (F   (Asq (r6   (Asq (r6 @ ( "(" (F   (Asq (r6   (Asq (r6 @ (" (F  (F   ( "(Asq (r6   (Asq (r6 @  ( "(F   (Asq (r6   (Asq (r6 A!A!@ (A0qA0F ( (hAvAq! ( " 6  -":  (6  -:  -:  /;  -:  -:  -:  -:  -:  -:  -:  -G A!   A:  A!  A! @@@@@  6 AF  ( "Aj" Ar"j- Aj" j-G   Ar"j-  j-G   Ar"j-  j-G #"E  Aj$A!  ( (Aj"j"- -F    A:  A! A! @@@@  ( "(!#׀! A Aj! A"6 E    A:  A!@@@ AG (AG #"E  Aj$  ( A:A!   A:  A!  A! 6  A6  ( "Aj! (! (!A!@@A t" q ( j"Aj-" Aj-F  j : @  qE  j -: Aj"AG ( !A"A6 #"Aj6  Aj6  6  A:D  Aj" A"6   A: #Aꁀj WA" 6 #"AɁj6  Aʁj6  A:  Aˁj   @@@@@@@@ - A! ( "-E  -Aq   @@@ Aj (  @@ Aj (  ("(! A!    # #Aj   A! @@@@  ( "(!#׀! A Aj! A"6 E    A:  A!@@@ AG (AG #"E  Aj$  A! ( A:   A:  A!  A! 6  A6 #Aˁj WA" 6 #"A􀀀j6  Aj6  A:  Aj   ~@@@@@@@@ - A! ( "-AF   )"7  (6  )7  )7  )7  )7  )7  )7   (Asq (r6  ( (Asq (r6  ( (Asq (r6  ( (Asq (r6  @@@ Aj (  @@ Aj (  ("(! A!    # #Aj   A! @@@@  ( "(!#׀! A Aj! A"6 E    A:  A!@@@ AG (AG #"E  Aj$  ( A:A!   A:  A!  A! 6  A6 #Aj WA" 6 #"Aj6  Aj6  A:  Aj   @@@@@@@@ - A! ( -AG   @@@ Aj (  @@ Aj (  ("(! A!    # #Aj   A! @@@@  ( "(!#׀! A Aj! A"6 E    A:  A!@@@ AG (AG #"E  Aj$  ( A:A!   A:  A!  A! 6  A6 #Aj bA " 6 #"Aj6  Aj6  6  A:  Aj   1#Ak"$ A j! Aj!@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ -   @ (" A! . (! (!A" Aj6 #"Aj6  Aj6  6  A:d #" A"6 E    A: . @@ Aj (  @@ Aj (  ("(!    A€ #ӀA"6 E    A: , @@ Aj (  @@ Aj (  ( ("(" A!A! ' @@ Aj (  @@ Aj (  (A! ( Aj! (Aj! A! A! (A-F   @@ Aj (  @@ Aj (  (A! % @@ Aj (  @@ Aj (  ("(! A! $ @@ Aj (  @@ Aj (  ("(! A! # @@ Aj (  @@ Aj (  (A! " @@ Aj (  @@ Aj Aj!  ( Aj!  @@ Aj ( @@ Aj Aj!  ( Aj! ( (! A!  @@ Aj (  @@ Aj (  ( A!  @@ Aj (  @@ Aj (  ( "(! A!  @@ Aj (  @@ Aj (  ( "(! A!  @@ Aj (   @@ Aj A j!  (   A j!  @@ Aj  (   @@ Aj  A j!  (   A j! ("(! A!  @@ Aj  (   @@ Aj  (   ( A!  @@ Aj  (   @@ Aj  (   ( "(!  @@ Aj  (   (  @@ Aj (   (  @@ Aj (   @@ Aj (   ( "(! A!     # #A܀j # #A܀j # #A܀j # #A܀j    A!  A!  A!  A!  A!  @@@  6@ (E !  @@@@@@ ("Aj Aj!  (Aj! A!  (Aj! A!  (( !  6D  6@ #Aj Aj #A"6  A! (Aj! A! 6 6 6 ("6 E #"E  Aj$A!  @ ("(A-G (Aj! (! (! (!A!  (Aj! (! (! 6 6A!    A:   A:  @@@@@@@@@@@@@@@@@@  6 A!@@ (" AUj Aj! ! 6 6 #! A=! A"6 E   A :   6#"Aj! A񐀀j!  ( !@ ( E ( ! ( !#؀!    kAuÀ! A"6 E    A :  #ǀ!  Ā! A"6 E   A:  @@  ( ! ( " E  (AF  ( ( "6   (( ! ( !  6T  6P #A뫀j Aj #A"6 @  A!    A:  (ŀ6 Aj6 @@ (E A" 6 #"Aj6  Aj6  A:|  Aj" A"6 E    A:  (-! A! A!@@@@@@@@@@@@@@@@@@ (     #! A͢j AjA Aj #ـA"6   A: $ A!  A!  A! A ! A! A! A ! A!  A !  A !  A !  A!  A!  A!  #! Aj AjA Aj #ـA"6   A:  A! ( j :  ( (A A!@@ Aj> Aj! : ( ; Aj! 9 A6 #Aj6#Aj(! A Aj #A"6 E    A: < @@ Aj< ( : @@ Aj< ( : ( #(6#Aj(! A Aj #A"6 E    A: : @@ Aj: ( 8 @@ Aj: ( 8 ( #"Aj6 Aj(! A Aj #A"6 E    A: 8 @@ Aj8 ( 6 @@ Aj8 ( 6 ( #Aj(!#("E  6 A Aj #A"6 E    A: 6 @@ Aj6 ( 4 @@ Aj6 Aj!  ( 3 Aj!  #6 A AjĊ #A"6 E    A: 4 @@ Aj4 ( 2 @@ Aj4 Aj!  ( 1 Aj! ( #Aj6X #"Aj6T AⓀj6P Aj(! A Aj #A"6 E    A: 1 @@ Aj1 ( / @@ Aj1 ( / ( A6h #"AⓀj6d Aj6` Aj(! A Aj #A"6 E    A: / @@ Aj/ ( - @@ Aj/ ( - ( #Aj6x #"Aj6t A񌀀j6p Aj(! A Aj #A"6 E    A: - @@ Aj- ( + @@ Aj- ( + ( A6 #"A񌀀j6 Aj6 Aj(! A Aj #A"6 E    A: + @@ Aj+ ( ) @@ Aj+ ( ) ( A6 #"Aj6 Aj6 Aj(! A Aj #A"6 E    A: ) @@ Aj) ( ' @@ Aj) ( ' ( A6 #"AԒj6 Aրj6 Aj(! A Aj #A"6 E    A: ' @@ Aj' ( % @@ Aj' ( % ( A6 #"Aܛj6 AĀj6 Aj(! A Aj #A"6 E    A: % @@ Aj% ( # @@ Aj% ( # ( A6 #"AԒj6 Aj6 Aj(! A Aj #A"6 E    A: # @@ Aj# ( ! @@ Aj# ( ! ( A6 #"Aܛj6 Aj6 Aj(! A Aj #A"6 E    A: ! @@ Aj! (  @@ Aj! (  ( A6 #"AԒj6 Aj6 Aj(! A Aj #A"6 E    A:  @@ Aj (  @@ Aj (  ( A6 #"Aܛj6 Aj6 Aj(! A Aj #A"6 E    A:  @@ Aj (  @@ Aj (  ( A6 #"Aj6 Aʀj6 Aj(! A Aj #A"6 E    A:  @@ Aj (  @@ Aj (  ( A6 #"Aj6 AЀj6 Aj(! A Aj #A"6 E    A:  @@ Aj (  @@ Aj (  ( A6 #"AКj6 Aՠj6 Aj(! A Aj #A"6 E    A :  @@ Aj (  @@ Aj (  ( A6 #"AÚj6 Aj6 Aj(! A Aj #A"6 E    A!:  @@ Aj (  @@ Aj (  ( A6 #"AКj6 AϠj6 Aj(! A Aj #A"6 E    A":  @@ Aj (  @@ Aj (  ( A6 #"AÚj6 Aj6 Aj(! A Aj #A"6 E    A#:  @@ Aj (  @@ Aj (  ( A6 #"AКj6 Aj6 Aj(! A Aj #A"6 E    A$:  @@ Aj ( @@ Aj ( ( A6 #"AÚj6 Aj6 Aj(! A Aj #A"6 E    A%: @@ Aj  ( @@ Aj  ( ( #Aj(! A #A"6 E    A&: @@ Aj  ( @@ Aj  ( ( #Aj(!#! ӂ! A"6 E    A': @@ Aj  (  @@ Aj  (  ("(!  (!# 6#Aj(!#! ӂ! A"6 E    A(:  @@ Aj (  @@ Aj (  ("(!  (! (!#  k6 (!#  k"6#( jA:#Aj(! A΅ #AсjA"6   A):  @@@ Aj Aj!  (  Aj! A! ( 6  A6      # \A" 6 #"Aj6  Aj6  6  A:  Aj  @@@@@ - (!A8" 6 #"Aj6  Aj6  A:4 #" A"6 E    A:  @@ Aj (  @@ Aj (  ("(!  ( (6  A6      #Aj WA" 6 #"Aj6  Aj6  A:  Aj   @@@@@@ - #(!A鼳#("E   ! A"6 E    A:  @@ Aj (  @@ Aj (  ("(!  A!@ AF ( 6A! 6  A6      #Aj #A6#( [A" 6 #"Aj6  Aj6  A:  Aj Aq  @@@@@ - ( !A" 6 #"Aj6  Aj6  A:B #" A"6 E    A:  @@ Aj (  @@ Aj (  ("-!  Aq6  A6      #Aj V#!A" Aj6  Aj6  A:  Aj Aq  @@@@@ - AA􀀀 #ŀA"6 E    A:  @@ Aj (   @@ Aj (   (  A6  A6      #Aj UA" 6 #"Aj6  Aj6  A:B #    @@@@@@@@@@@@@@@@@@@@@@ -B  @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:B  @@ Aj (  @@ Aj (  ( #(E  A:A ( :@#Aj(!A " Aj6 #"Aj6  Aj6  6  A: #" A"6  A! @@ Aj (  @@ Aj (  (!A! #("E A E  ! A"6 E    A:B  @@ Aj ( @@ Aj ( ("(!   #(! 6#Aj(!A8" 6 #"Aj6  Aj6  A:4 #" A"6 E    A:B @@ Aj  (  @@ Aj  (  ( "(!  (! (!#  k6 (!#  k"6#( jA: #"Aj(6$ #(6( #(6,#(!A(" A􏃀j6 #"Aj6  Aj6  6  A:$ #" A"60 E    A:B @@ Aj  (0  @@ Aj  (0  (0"(!  64#! (!#!  Aj! A"68 E    A:B  @@ Aj  (8  @@ Aj  (8  (8"(!  #!#(! ($! ((! (,! (4!#!#! #! #!      Aj # AՇ! A"6< E    A:B  @@ Aj (<  @@ Aj (<  (<"(!  6  A6      A:B #   (#Aȃj"A: #(:  UA" 6 #"Aj6  Aj6  A:\ #    Aj!@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ -\   (6@#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6$ E    A:\  @@ Aj ($  @@ Aj ($  ($ #("E A E   A"6( E    A:\  @@ Aj (( @@ Aj (( (( #Aj(!A0" 6 #"Aj6  Aj6  A:,  Aj" A"6, E    A:\  @@ Aj  (, @@ Aj  (, (, #A6#Aj A @@ Aj  (4  @@ Aj  (4  (4"(!  @@ Aj  (8  @@ Aj  (8  (8 @@ Aj  (<  @@ Aj  (<  (< @@ Aj (@  @@ Aj (@  (@ @@ Aj (D  @@ Aj (D  (D"(!  @@ Aj (H  @@ Aj (H  (H"(!  @@ Aj (P  @@ Aj (P  (P  @@ Aj (X  (T! (X 6  A6       (!A8" 6 #"Aj6  Aj6  A:4 #" A"64 E   A:\ @ AG A! #("E A E   A"68 E   A:\ #Aj(!@#( A!  -Aq  #"Aj6 A" A j6  Aj6  Aj6 A 6  6  A: #" A"6< E   A:\ #"AjA: Aj(!#(E! #! E  Aj-AqE  A60A" A0j6 #"Aj6  Aj6 A 6  6  A: #" A"6@ E   A:\  #"AjA: Aj(! #A6A4" 6 #"A񁀀j6  A򁀀j6  6  A:0 #" A"6D E   A:\  A! E  (AH #瀀! ! A"6H E   A :\  @  A!   (jAj"A -" A F: 6L#Aj(!#!A" Aj6  Aj6 B7$  A j6  6  A: #" A"6P E   A :\  ( !# 6 (L! 6T#Aj(!A"A6 #"Aj6  Aj6  6  A:  Aсj" A"6X   A :\ # ^A8" 6 #"Aj6  Aj6  6  A:4  Aj   #Ak"$ A5j! A j!@@@@@@@@@@@@@@@@@ -4 A! A:5 (A6#("E A E A!  @@ Aj (  @@ Aj (  (A!  @@ Aj (   @@ Aj (   ( "(! A!  @@ Aj ($  @@ Aj ($  ($"(! A!  @@ Aj (,  @@ Aj (,  (, ((!    # #Aj   A! @@@@@@@@@@@@@@    A"6 E   A:4  ((!  6#ˀ! A ߀! A"6 E   A:4  A!@ AN A!  (E  ((!#!  A뀀! A"6$ E   A:4  AJ (!#(! A G  E  A (0E (0!  #(!   E  60#"E  Aj$A!     A:4 A!  A!  A!  A!   6( A6 (!A" Aj6 #"Aj6  Aj6 A 6  6  A: #" A"6, E   A:4  ( ,56 6  A6 #Aj Aj$ M#!A" Aj6  Aj6  A: #  @@@@@ - @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:  @@ Aj (  @@ Aj (  ( #(!# 6  A6      # dA" 6( #"Aj6  Aj6  6$  6  A: #   ##Ak"$ Aj!@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ -  ($("6,@  ("j-"#-F A! 1  Aj"j-":@  F   #Aj(!#!A" Aj6  Aj6 B7$  6  6 A! A: #" A"64 E 0   A: 1 @@ Aj (4  @@ Aj (4  (4"(! @ E A! 0 ($ (,"Aj Aj"  (j-6 (! /  Aj  A-F"j-": APj"AqA K   Aj"j-"APjAqA I  , @@ Aj (<  @@ Aj (<  (<"(!   ,A! -  A?Fj!A!  @@ Aj (L  @@ Aj (L  (L"(!   @@ Aj (T  @@ Aj (T  (T (@! (H! (P!  @@ Aj (d  @@ Aj (d  (d"(!   @@ Aj (h  (hA! ( @@ Aj (p (`! (p#Aԏj 6  @@ Aj (t A! Aj  @@ Aj (x A!@ Aj (x  @@ Aj (| @@ Aj (| (|  @@ Aj  ( @@ Aj  ( (  @@ Aj  (  (A! " @@ Aj  (  (`! (#瀀! ! A"6 E    A: " @@ Aj  (  @@ Aj  (  ("(!  #A؏j 6  @@ Aj (  (  @@ Aj (  @@ Aj (  ("(!   @@ Aj (  @@ Aj (  ( (!  (tE    # #Aj # #Aj    A!  A!  A! @@@@@  : 6 6#"E  Aj$A!  (A l -jAPj! ( (Aj"j-"APjAqA O    A:  A! @@@@@@@@  6@@ ( j,"Aq"  -!@ A?G AqA?G  (,kA}A~ -A-Fj! @ AqA?F A F  A F  A:F  (( F  #"E  Aj$A!  (@Aj!   (,kA~A -A-Fj!   (,k -A?F"kA~A -A-Fj!   ! AA -A-F (,jG A!   A:  A! j("(!    A?Fj! -! (,!#!@  AA A-FjAj"G Aԏj("E -   G A!  6D 6H#! AjA! A"6L E   A:  6P@  A!  -! (,! (! -! (D!   jAA A-Fj A?Fj Aj€ #ӀA"6T  (@! (H! 6\ 6` 6X#Aj(!#!  AAʊ! A"6d E   A:  @ E #!@ (`" Aԏj(G A!    #A"6h   A:  (6l (`! -A?G  #Aԏj("F   #A"6p   A: (`!#! A! A"6t E    A: 6 #Aj(!#!  A jA A jʊ! A"6x E   A : AG #Aj(!  AAʊ #A"6| E   A : #(! (`!  6 #Aj  #A"6 E   A : #!@ (`" Aԏj(G A!    #A"6   A :  -"A?G (X (, A?FjAA -A-FjF #A؏j(!  #A"6   A :  #! (`" Aԏj(F   #A"6   A:  #Aj(!#!  AAʊ! A"6 E   A:  @ E A!  (l! ($ (\6 ("6 60#Aj(!  A A0jʊ #A"6 E    A:    A:  68#!#(!#(! -!A" Aj6  Aj6    kj  A-F6  A:L #" A"6< E   A:  ($ (86 (! 6  A6 # Aj$ UA" 6 #"Aj6  Aj6  A:L #    A j!@@@@@@@@@@@@@@@@ -L @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:L  @@ Aj ( @@ Aj ( ( #!@ ( (N A! #Aj(!#!A" Aj6  Aj6 B7$  6  6 A! A: #" A"6 E   A:L @@ Aj  ( @@ Aj  ( ("(! @ E A! A6$ ( 6(#! ( (k6 #Aj(!#!  A A jʊ! A"6, E    A:L @@ Aj  (, @@ Aj  (, (,"(!  @ E A!  #Aj(!#!  AAʊ! A"68 E    A:L @@ Aj  (8  @@ Aj  (8  (8"(!  @ E A!  ( 60 #"A܏jAj64 Aj(!#!  A A0jʊ! A"6< E    A:L  @@ Aj (<  @@ Aj (<  (<"(!  @ E A!  #A܏j" (6 6D ((6@#Aj(!A" Aj6( #"Aj6  Aj6 A6$  6  6  A: #" A"6H E    A:L  @@ Aj (H  @@ Aj (H  (H (D! 6  A6      # [A<" 6 #"Aj6  Aj6  6  A:8 #    A j!@@@@@@@@@@@@@@@ -8 #Aj(!#!A" Aj6  Aj6 B7$  6  6  A: #" A"6 E   A:8 @@ Aj (  @@ Aj (  ("(!   ( 6$  @@ Aj (,  @@ Aj (,  (,"(!   @@ Aj (0  @@ Aj (0  (0"(!  E   @@ Aj (4  @@ Aj (4  (4    @#"E Aj$   A:8  # #A䑀j   ("6( (!#!  ! A"6, E   A:8  @ E  ((k!  #Aj(! (!A"A6( #"Aj6  Aj6 AA AH6$  6  6  A: #" A"60 E   A:8  ($6 #Aj(!A" A j6( #"Aj6  Aj6 A6$  6  6  A: #" A"64 E   A:8  A! 6  A6 # [A(" 6 #"Aj6  Aj6  6  A:$ #   @@@@@ -$ (6 #Aj(! (!A" A j6( #"Aj6  Aj6 AA AH6$  A j6  6  A: #" A"6 E    A:$  @@ Aj (  @@ Aj (  ("(!  6  A6      # ]A" 6 #"Aj6  Aj6  6  A: #   ҍ2#Ak"$ Aj! Aj! A j!@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ -N  !"#$%')*+,-./0123456789:;<=>?@ABCDFGHIJKLMNO[RSTUVWXYZ @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6$ E    A:  @@ Aj\ ($ P @@ Aj\ ($ P ($ #-  (!#瀀! ! A"6( E    A: ~ @@ AjZ (( N @@ AjZ (( N (("(!  ( 6A! K (! (A6#-! -! (!  G #! ƀ! A"6, E    A: { @@ AjW (, K @@ AjW (, K (,"(!  #! AjA! A"60 E    A: y @@ AjU (0 I @@ AjU (0 I (0"(!  ( 6@  A! G (! #-" : A;  : Aj ǀ #̀A"64 E    A: w @@ AjS (4 G @@ AjS (4 G (4 (!  #瀀! ! A"68 E    A: t @@ AjP (8 D @@ AjP (8 D (8"(!  ( 6@  A! B Aj! (" 6 @@ AjJ (l > (l"(! A! U @@ AjI (t = @@ AjI (t = (t"(! A! T @@ AjH (x < (xA #A"6|   A : k @@ AjG (| ; (|A! 9 @@ AjF ( : @@ AjF ( : (A! Q @@ AjE ( 9 @@ AjE ( 9 ("(!  d @@ AjD ( 8 (A #A"6   A: g @@ AjC ( 7 (A! 5 @@ AjB ( 6 @@ AjB ( 6 ( c @@ AjA ( 5 @@ AjA ( 5 ("(! A ! L @@ Aj@ ( 4 @@ Aj@ ( 4 ("(! A ! K @@ Aj? ( 3 @@ Aj? ( 3 (A ! J @@ Aj> ( 2 @@ Aj> ( 2 ("(! A! E %A ! I @@ Aj= ( 1 @@ Aj= ( 1 ("(! ( @@ Aj2 ( & @@ Aj2 ( & ("(! A! = @@ Aj1 ( % @@ Aj1 ( % ("(!  O @@ Aj0 ( $ ( (! (!! (!" (! 2 @@ Aj/ ( # @@ Aj/ ( # ("(!# A! : @@ Aj. ( " @@ Aj. ( " ("(!$ A! 9 @@ Aj- ( ! @@ Aj- ( ! ("(!  J @@ Aj, ( ( (! (!! (!" (! . @@ Aj+ (  @@ Aj+ (  ("(! A! 6 @@ Aj* (  @@ Aj* (  ("(! A! 5 @@ Aj) (  (#Aȃj!% D @@ Aj( (  @@ Aj( (  ("(!% A! 3 @@ Aj' (  @@ Aj' (  ("(!& A! 2 @@ Aj& (  @@ Aj& (  ("(!& A! 1 @@ Aj% (  @@ Aj% (  ( ( (j!' (!( & A!@@ Aj$ (  (#Aȃj"%(! @ @@ Aj# (  @@ Aj# (  ("(!) A! . @@ Aj" (  @@ Aj" (  ("(!* A! - @@ Aj! (  @@ Aj! (  ("(!+ A! , @@ Aj  (  @@ Aj  (  ("(!, A ! + @@ Aj (  @@ Aj (  ("(!- A!! * @@ Aj (  @@ Aj (  ("(!. A! * @@ Aj (  @@ Aj (  (A! ) @@ Aj (  @@ Aj (  ( 6 @@ Aj (  ( (!! (! (!A"! & @@ Aj (  (! ( A6 (! (! 2 @@ Aj ( ( (! A%! # @@ Aj ( @@ Aj ( ("(!  ) @@ Aj ( @@ Aj ( ("(!  ) @@ Aj ( (! (  #A"6   A=: 8 @@ Aj (  (A!  @@ Aj (  @@ Aj (  ( (T (j (Pk (Dj! (! (! * @@ Aj (  ( Aj!/ Aj!0 (! (!1A&!  @@ Aj (  @@ Aj (  (  @@ Aj (  @@ Aj (  ("(!   @@ Aj (  @@ Aj (  (  @@ Aj (  (! (! (  6 (! 6  A6 0   0 # #Aj # #Aj # #Aj # #Aj # #Aj # #Aj # #Aj # #Aj # #Aj # #Aj   % A! A! A! A#!  A$!  A'!  A(!  A)!  A*!  A+!  A,!  A!  @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ -  !$%&'()-./012347:>@FINTT 6L 6P 6H 6D 6@A!A!A!2 !  (\! ( ɀ"6 ( Atj-Aq  (< (Tj (jAj! A!A! < (< (Tj (j!@ APj"AqA I Aj!A! 6 Aj! -"APjAqA I 8 5 AA -j(! #瀀! ! A"6@  (< (Tj (jAj! S   A: } 6 6 - R (!  #A"6   A: | Aj! (" -"E A!! (< (T"jk (\ kO A!"  E  A:  E #瀀! Aj! A"6 E t   A!: y #E  #A:  $  (! (! (!! (!"  #瀀! $Aj! A"6 E o   A%: u @ E ("Aj!A! -"2E (A! -Aq 2F ( & #Aȃj!% l @ E (At! & (!  #A"6   A): s %6#Aȃj(!#! A!& A"6 E P   A+: r A!#AȃjA6 &E  ("-"E  -Aq F  Aj!2A!A!  @ & (!  ( (jAj! (-!  '6 (6 (-":@ E -Aq G  (6 ("6 E   6 &6A!' &! E  (!)  'jA:#"Aȃj 6 Aȃj(6#! )ƀ!) A"6 E M   A/: m   #A"6   A.: l )6 (!#! ƀ!* A"6 E L   A0: k *6 (!#! ƀ!+ A"6 E L   A1: j +6@ ("-"2 (!  (-: Aj!  (!A! ,  ( ("k j! (E   -6@ - (! (!! (! M ("-"E ]A! P A!"  !6 "6 6 6 -:#"E Aj$A$! M Aj! (Aj! (!! (!" -! "6 !6 6 ("6@@@@@@@@@ Aq"AZjO      AA !! #! A/! A"6 E A   A: j #! A/! A"6 E A   A : i #! A.!# A"6 E A   A#: h #! A.!$ A"6 E A   A$: g A!!  A!"  #"Aȃj(E  Aȃj(E  -":A! E X -E X#Aȃj(!#! A! A"6 E >   A': c A#! J Aj!0 Aj!/ (T (Pk (Dj!1 H (!A! 6 6@ AH E #! ƀ! A"6 E O   A:: ` @  Aj!0 Aj!/ (T (Pk (Dj!1 G (T (Pk (Dj! (! (! S 16 /("6 0(6 (< (\j-  AG ]@#"Aj("E Aj( J  #A"6 E H   A: ^ ((!  #A"6x   A : ]  A: \ #"E  Aj$A'! C (< (\" j! (! (! (!  A: Y Aj! ( (j! -!2 6 ("6A! 2Aq -G (! (!#؀!2   À!, 2A"6 E :   A2: W 6 6 ( j-":   #! AjA!- A"6 E 9   A3: U #"E  Aj$A(! < #"E  Aj$A)! ; (Aj!2 (! (!& (! -! 6 6 26 &6 (Aj"2 j I #! & 2 j!& A"6 E 0   A,: Q 6 &6@@@@ Aq"A&F AF  (!(  (! (!( & j (ǀ #̀A"6@  ( (j!' (!(    A-: S ("Aj  -"(A&F - (Fr"'!(  'j-! & ("j : Aj!' A! 8 (Aj! (Aj! (! (! -!2 6 6 6@ 2AqAG Aj  - -F! 6 Aj I #!  At! A"6 E *   A(: N 6 6 -!  ("2j ("-: -": Aj!@ E Aq G  2Aj! 6 6  jA:#Aȃj"% 6A! -E E#!%@ - %Aȃj!% F #!%@ - %Aȃj!% F #! ƀ!% A"6 E )   A*: L #"E  Aj$A*! 3 ("Aj! (A l -jAPj! -"APjAqA I  !@ AqAVj (! ! 6 Aj!@ ( -"Atj-AqE APj"AqA M A!  Aj  A$F"!AA~ !  Aj!A!  : 6 6#"E Aj$A+! . Aj! -"APjAqA O   ("Aj! (A l -jAPj! -"APjAqA I  (! 6 AA -j(!A" 6 #"A†j6  AÆj6  6  6  A:p #" A"6 E    A: C : 6 6#"E  Aj$A,! *  A: A  A: ?  A: >  A: =  A: <  A: ;  A: : A! ! A! A!  A!  A!  A!  A!  A !  A !  A !  A !  A !  A!  A!  A!  A!  A!  A!  A!  A!  A! A! A! A! A! A!  A!  A!  A!  A !  A!!  A"!  A%!  A&! @@@@@@@@@@@  : 6 -6 Aq ("-G  (!#؀!   À!. A"6 E    A4: .  (! (! (!    #A"6 E    A5:  ( (j! ( (j!- (  - ǀ #̀A"6 E    A6:  (! (" -: Aj!- Aj! -6 6 -": E #"E  Aj$A!  (!- (! -!   A:  A!  A!  A! #Aj(! (6 #!  A A jʊ! A"6 E   A:  AF #Aj(!  AAʊ #A"6 E   A:  #!@ (" (G #" (Aj6  # 6#" (Aj6 (!A!  6 (! Aj" (Tj (Pk (Dj ("M #!   j! A"6 E   A;:  E  ( (jAj! 6 6 (! (P! (T! (D!& (!! &  kjj ! Aj€ #ӀA"6   (T (j (Pk (Dj!  ((!  #A"6   A<:   A>: 6 6 6 (!  #A"6   A?: 6  #A"6   A9: -A: (!  #A"6   A7:  %(!A! %6 6  #A"6   A8:  6 (!  #A"6   A&:  6 (!  #A"6   A":   ((!  #A"6   A:  6 (T! ( #!#!  Aעj! A"6 E    A:! ? @@ Aj  (   @@ Aj  (   ( "(!  6 A!   ( ! 倀 #ހA"6 E    A :! = @@ Aj (   @@ Aj (   (  (! 8 @@ Aj (   @@ Aj (   ( "(! A!  @@ Aj (   @@ Aj (   ( "(!  @@ Aj (   @@ Aj (   ( "(!  @@ Aj (!  @@ Aj (!  (!"(!  @@ Aj (!  @@ Aj (!  (!"(!  @@ Aj (!  @@ Aj (!  (!"(!  @@ Aj (!  @@ Aj (!  (! (!! (!! # @@ Aj (!  @@ Aj (!  (!"(! A!  @@ Aj (!  @@ Aj (!  (!"(! A! " @@ Aj (! @@ Aj (! (!"(! A! ! @@ Aj (! @@ Aj (! (!"(!  + @@ Aj (! @@ Aj (! (!"(!  @@ Aj (! @@ Aj (! (!"(!  @@ Aj (! @@ Aj (! (!"(! A! ! @@ Aj (!  @@ Aj (!  (!"(!  ! @@ Aj  (!  @@ Aj  (!  (!"(! A!  @@ Aj  (!  @@ Aj  (!  (! " @@ Aj  (!  @@ Aj  (!  (!")!  " @@ Aj  (!  @@ Aj  (!  (! " @@ Aj  (!  @@ Aj  (!  (! (!! $ @@ Aj (!  @@ Aj (!  (! (!! $ @@ Aj (!  @@ Aj (!  (! (!! $  # #A՗j # #A՗j # #A՗j # #A՗j   A!  A!  A! A! @@@@@@@@@  6 ( !#Á! A A ! A"6 E    A :! " @ AF ( !#ā! ! A"6 E   A :! " ( !#Ł! A A ! A"6! E    A:! ! AG #"E  Aj$A!  ( Aj!   A!:!  A!  A!  A!     5 ! ( !#Ɓ!  B A! A"6 E   A :!  AF  ( !#Á! AA ! A"6! E   A :!  6! ( !#ā! ! A"6! E   A:!  (!!  @  ( Aj!A !  ( !#Ł!  A ! A"6! E   A:!  (!! AG  ( ! 6! 6! ( !  #ҀA"6! E    A:!  A! (" ( ! Aj"   j-A F! A j! !A! @@@@@@@@@@@@@@@  7  Aj"j! (! AH   @ AJ (!  ( !#Á! A A ! A"6! E   A:!  @ AF ( !#ā! ! A"6! E    A:!  #"E  Aj$A! A!j! ) B|!A !   (!"Aj"j! (!! 6!@ -A G Aj" ) AK"|! A  j!  6! AJ  Aj! 6! ) !@ AH P ( !#Ɓ!  B B`|A! A"6! E    A:!  A! AJ  7 6! ( !#Ɓ! BA! A"6! E    A:!  #"E  Aj$A!   A#:!   A :!  A!  A!  A! @ AG (! ) ! (!! ( !#Ɓ!  B B  k|A! A"6! E   A:!  AG (! A! @@@@@@  ( !#Á! AA ! A"6! E    A:!   ( !@ #ā! ! A"6! E    A:!  #Ł!  A ! A"6! E    A:!  AG @@#"E Aj$   A":!  A!  A!  A!  A!  (! 6! ( !  #ҀA"6! E   A:!  ( !#ǁ! ! A"6! E   A:!  BW ( ΀!   #ȁA"6! E   A:!  (!!  @  A !  (! 6! ( ! Ԁ #A"6! E   A:!  6! 耀 #ကA"6! E   A:!  6! ( ! Ԁ #A"6! E   A:!  6  A6 # Aj$ UA" 6 #"AІj6  Aцj6  A:D #Ɂ   #Ak"$ A j!@@@@@@@@@@@@@@@@@@@@@@@@@ -D  @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:D  @@ Aj (  @@ Aj (  ( (" #Aȃj(" !#! ! A"6 E    A:D  @@ Aj (  @@ Aj (  ("(!  6$ E  (!#! ƀ! A"6( E    A:D  @@ Aj ((  @@ Aj ((  (("(!  6,#! A j! A"60 E    A:D  @@ Aj (0 @@ Aj (0 (0"(!  #Aȃj 6 E  (,! ($(!  6  A j#Aāj  #A"64 E    A:D  @@ Aj  (4 @@ Aj  (4 (4 #Aȃj("  (!  "68 A6 6 #Aj(!A" A j6( #"Aj6  Aj6 A6$  6  6  A: #" A"6< E    A:D @@ Aj  (<  @@ Aj  (<  (<"(!  @ AG (8("A !  #Aj(!#!A" Aj6  Aj6 B7$  6  6  A: #" A"6@ E    A:D  @@ Aj (@  @@ Aj (@  (@"(!  E  #(!  (!# 6 AuAq! 6  A6       #Ɂ Aj$ UA" 6 #"A҆j6  Aӆj6  A:< #ʁ   #Ak"$@@@@@@@@@@@@@@@@@@@@@ -< @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:<  @@ Aj (  @@ Aj (  ( (" #Aȃj(" !#! ! A"6 E    A:<  @@ Aj ( @@ Aj ( ("(!  6$ E  (!#! ƀ! A"6( E    A:<  @@ Aj  (( @@ Aj  (( (("(!  6,#! A j! A"60 E    A:< @@ Aj  (0 @@ Aj  (0 (0"(!  #Aȃj 6 E  (,! ($(!  6  A j#Aāj  #A"64 E    A:< @@ Aj  (4  @@ Aj  (4  (4 #Aȃj("  (!  6 #Aj(!A" A j6( #"Aj6  Aj6 A6$  A j6  6  A: #" A"68 E    A:<  @@ Aj (8  @@ Aj (8  (8"(!  A! AG ("A ! 6  A6       #ʁ Aj$ \A" 6 #"AԆj6  AՆj6  6  A:X #ˁ   #Ak"$@@@@@@@@@@@@@@@@@@@@@@@@@@ -X   @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:X  @@ Aj (  @@ Aj (  ( (" #Aȃj(" !#! ! A"6( E    A:X  @@ Aj ((  @@ Aj ((  (("(!  6, E  (!#! ƀ! A"60 E    A:X  @@ Aj (0  @@ Aj (0  (0"(!  64#! A j! A"68 E    A:X  @@ Aj (8  @@ Aj (8  (8"(!  #Aȃj 6 E  (4! (,(!  6  A j#Aāj  #A"6< E    A:X  @@ Aj (< @@ Aj (< (< #Aȃj("  (!  #!#!  AjҀ! A"6@ E    A:X @@ Aj  (@  @@ Aj  (@  (@"(!  6D@  (!  6$ (6 #Aj(!A" A j6( #"Aj6  Aj6 A6$  A j6  6  A: #" A"6H E    A:X  @@ Aj  (H  @@ Aj  (H  (H"(!  (D! AG  ("6L Ԁ #A"6P   A !  @@ Aj (P  @@ Aj (P  (P (L"A !   ԀA! #A"6T E    A :X  @@ Aj (T  @@ Aj (T  (TA! 6  A6       A:X #ˁ    Aj$ cA" 6 #"Aֆj6  A׆j6  6  6  A:\ #́    A j!@@@@@@@@@@@@@@@@@@@@@ -\   @#"Aj("E Aj(  #!A" Aj6  Aj6  A: #" A"6( E    A:\  @@ Aj ((  @@ Aj ((  (( #Aj(! #!A" Aj6  Aj6 B7$  6  6 A! A: #" A"6, E   A:\  @@ Aj (, @@ Aj (, (,"(!   ( 68#Aj(!#!A" Aj6  Aj6 B7$  6  6 A! A: #" A"6< E   A:\  @@ Aj (< @@ Aj (< (<"(!   #!A! A"6D E    A:\ @@ Aj (D @@ Aj (D (D"(!  6H E  Aj6$ (6 #Aj(!#!  A A jʊ! A"6L E    A:\ @@ Aj  (L @@ Aj  (L (L"(!    (H ("6 E  )70#Aj(!#!  A A0jʊ! A"6P E    A:\ @@ Aj  (P  @@ Aj  (P  (P"(!    (86@#Aj(!#!  A Ajʊ! A"6T E    A:\  @@ Aj  (T  @@ Aj  (T  (T"(!    (H!  @@ Aj (X  (X A! 6  A6    (H!  #A"6X   A:\ #́   M#!A" A؆j6  Aنj6  A: #́  @@@@@@@@@ - @#"Aj("E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:  @@ Aj (  @@ Aj (  ( #Aj(! #!A" Aj6  Aj6 B7$  Aj6  6  A: #" A"6 E    A:  @@ Aj (  @@ Aj (  ( #A6#A6  A6      #́ #( O#!A0" Aچj6  Aۆj6  A:, #΁    A j!@@@@@@@@@@@@@@@@@@@ -, #Aj(!#!A" Aj6  Aj6 B7$  6  6 A! A: #" A"6 E    A:,  @@ Aj  (  @@ Aj  (  ("(! @ E A!  #(!#A䏃j(!#!  AtAj! A"6 E    A:,  @@ Aj  (  @@ Aj  (  ("(!  @  A! #"A䏃j 6#(! A菃j(!#!  At! A"6 E    A:,  @@ Aj (  @@ Aj (  ("(!  @  A! #"A菃j 6A! A6  (6 A䏃j( 6#(  @@ Aj (   (  @@ Aj ((  @@ Aj ((  (("(!  E     #"E  Aj$  # #A΃j    A:,  ($!#"A䏃j( Aj"Atj A菃j( Atj"6 A6  (6 #(F  ($Aj! 6$#Aj(!#!A" Aj6  Aj6 B7$  6  6  A: #" A"6( E   A:,  ($!#A䏃j(" AtjA6 6  A6   #A"6   A:, #΁ O#!A$" A܆j6  A݆j6  A: #ρ   @@@@@ - #(Aj6 #Aj(!A" A j6( #"Aj6  Aj6 A6$  A j6  6 A! A: #" A"6 E    A:  @@ Aj (  @@ Aj (  ("(! A!  #A쏃j"A6  (6 6  A6      #ρ O#!A<" Aކj6  A߆j6  A:8 #Ё    A j!@@@@@@@@@@@@@@@@@@ -8 #Aj(!#!A" Aj6  Aj6 B7$  6  6  A: #" A"6  A!  @@ Aj  (  @@ Aj  (  ("(! @ E A!  ( 6#Aj(!#!A" Aj6  Aj6 B7$  6  6 A! A: #" A"6 E   A:8  @@ Aj  (  @@ Aj  (  (A! @@ Aj ((  @@ Aj ((  (("(!  @@ Aj (0  @@ Aj (0  (0"(!  E  @@ Aj (4  @@ Aj (4  (4 ($ (,j!     A:8 #"E  Aj$  # #Aڈj    A:8  ($ (,j! 6$ (!#! ƀ! A"6( E   A:8  6,#Aj(!#!A" Aj6  Aj6 B7$  6  6  A: #" A"60 E   A:8  (6 #Aj(!A" A j6( #"Aj6  Aj6 A6$  6  6  A: #" A"64@  ($ (,j!    A:8  6  A6 #Ё 5A!#!@ AH (N # 6A!  O#!A," Aj6  Aᆀj6  A:( #с   @@@@@@@ -( @#( A!  #Aj(!#!A" Aj6  Aj6 B7$  Aj6  6 A! A: #" A"6 E    A:(  @@ Aj (  @@ Aj (  ("(! @ E A!  #"("6  Aj6#Aj(!A" A j6( #"Aj6  Aj6 A6$  A j6  6 A! A: #" A"6$ E    A:(  @@ Aj ($  @@ Aj ($  ($"(! @ E A!  #A쏃j"A6  (6 6  A6      #с O#!A," Aↀj6  Aㆀj6  A:( #ҁ   @@@@@@@ -( #(!@#( H A!  #Aj(!#!A" Aj6  Aj6 B7$  Aj6  6 A! A: #" A"6 E    A:(  @@ Aj (  @@ Aj (  ("(! @ E A!  #" ("Aj6 Aj6 #Aj(!A" A j6( #"Aj6  Aj6 A6$  A j6  6 A! A: #" A"6$ E    A:(  @@ Aj ($  @@ Aj ($  ($"(! @ E A!  #A쏃j"A6  (6 6  A6      #ҁ \A" 6 #"A䆀j6  A冀j6  6  A:< #Ӂ    A j!@@@@@@@@@@@@@@@@ -< (" Au"s k6#Aj(!#!A" Aj6  Aj6 B7$  6  6  A: #" A"6$ E   A:<  @@ Aj  ($  @@ Aj  ($  ($"(! A!  ( 6(#! (" (N # 6#Aj(!#!A" Aj6  Aj6 B7$  6  6  A: #" A"6, E   A:< @@ Aj (,  @@ Aj (,  (,"(!    @@ Aj (0  @@ Aj (0  (0"(!   @@ Aj (4  @@ Aj (4  (4"(!  E   @@ Aj (8  @@ Aj (8  (8    @#"E Aj$   A:<  # #Aj   (! (!#!  ! A"60 E   A:<  @ E (!  #Aj(! (!A"A6( #"Aj6  Aj6 AA AH6$  6  6  A: #" A"64 E   A:<  ((6 #Aj(! (!A" A j6( #"Aj6  Aj6 AA AH6$  6  6  A: #" A"68 E   A:<  A! 6  A6 #Ӂ TA" 6 #"A憀j6  A熀j6  A: #ԁ   @@@@@ - ( !A " 6, #"Aj6  Aj6  A: #񀀀" A"6 E    A:  @@ Aj (  @@ Aj (  ("(!  6  A6      #ԁ [A" 6 #"A膀j6  A醀j6  6  A: #Ձ   ~@@@@@ - #! ) !A" Aj6  Aj6  7  A: #􀀀" A"6 E    A:  @@ Aj (  @@ Aj (  ("(!  6  A6      #Ձ [A4" 6 #"Aꆀj6  A놀j6  6  A:0 #ց   @@@@@@@@@@@@@@ -0 @ ( "-" A! @ AG Aj! 6 (  #ׁA"6   A:0 @@ Aj  (  (  @@ Aj (  @@ Aj (  ("(! A!  @@ Aj ($  @@ Aj ($  ($"(! A!  @@ Aj ((  ((!A!  @@ Aj (,  @@ Aj (,  (,"(!     # #Aҍj   A! @@@@@@@@@  #؁!! A"6 E    A:0 E  ("-! ("6  -G #ǀ!  Ā! A"6$ E    A:0  E  ( !#瀀! ! A"6, E    A:0   #فA"6(   A:0  @@#"E Aj$   A:0  A!  A!  A! 6  A6 #ց `A" 6 #"A솀j6  A톀j6  6  6  A: #ځ  ~@@@@ - #Aj(!#! )! (!A" Aj6  Aj6  Aj6  6  7  6  A:l #" A"6   A:  @@ Aj (  (  A6 #ځ     [A" 6 #"Aj6  Aj6  6  A: #ہ   @@@@@ - @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:  @@ Aj (  @@ Aj (  ( A!@ (#܁G #Aj(( ( jA :A! 6  A6      #ہ [A$" 6 #"Aj6  A񆀀j6  6  A:" #܁   @@@@@@@@@@@@@ -" @#"Aj(E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:" @@ Aj (  @@ Aj (  ( A:! (: ( "AH   @@ Aj (  (! ( AK  A6  A6    #"E  Aj$  # #Aj    A:"  (Aj! 6#Aj(!A" A j6 #"A큀j6  Aj6  6  A: #" A"6   A:" #܁ O#!A " A򆀀j6  A󆀀j6  A: #݁   @@@@@@@@@ - @#"Aj("E Aj(  #!A" Aj6  Aj6  A: #" A"6 E    A:  @@ Aj (   @@ Aj (   (  #Aj(! A$" Aj6 #"A끀j6  A쁀j6  6  A: #" A"6 E    A:  @@ Aj (  @@ Aj (  ("(!  6  A6      #݁ O#!A" A􆀀j6  Aj6  A: #ށ   @@@@@@@@ - @#"Aj(E Aj("  #!A" Aj6  Aj6  A: #" A"6 E    A:  @@ Aj (   @@ Aj (   (  #Aj(! A" 6 #"Aفj6  Aځj6  A: #" A"6   A:  @@ Aj (  ( A6  A6 #ށ     TA " 6 #"Aj6  Aj6  A: #߁   @@@@@@@@@@@ - A! ( "E  -E @#"Aj(E Aj("  #!A" Aj6  Aj6  A: #" A"6 E    A: @@ Aj  (  @@ Aj  (  ( #Aj(! ( !A " 6 #"Aj6  Aj6  6  A: #" A"6 E    A:  @@ Aj (  @@ Aj (  ("(!  A! AH  ( !#! ƀ! A"6 E    A:  @@ Aj (  @@ Aj (  ("(!  6  A6      #߁ O#!A" Aj6  Aj6  A: #   @@@@@@@@ - @#"Aj(E Aj("  #!A" Aj6  Aj6  A: #" A"6 E    A:  @@ Aj (   @@ Aj (   (  #Aj(! A ;A" Aj6 #"A큀j6  Aj6  6  A: #" A"6   A:  @@ Aj (  ( A6  A6 #     cA" 6, #"Aj6  Aj6  6  6  A:D #၀    A @@ Aj" (\  @@ Aj" (\  (\"(!  E : (0 6 ! 6` 6d@@ -AAqE A!  @ (H" A!  (! 6h AA #A"6l E    A: ; @@ Aj (l  @@ Aj (l  (l @A (<" AF" (P! (h! $ Aj! (8! (P! A! " @@ Aj (|  @@ Aj (|  (|"(! A! ! @@ Aj (  ( @@ Aj (  ( @@ Aj (  ( @@ Aj (  @@ Aj (  ("(!   @@ Aj (  @@ Aj (  (" (!   @@ Aj (  @@ Aj (  (  @@ Aj (  @@ Aj (  (" (!   @@ Aj (  @@ Aj (  (" (!  $ @@ Aj (  @@ Aj (  ("(! A! $ @@ Aj ( @@ Aj ( ("(!  & @@ Aj ( @@ Aj ( ( & @@ Aj ( @@ Aj ( ("(! A! & @@ Aj ( @@ Aj ( ( (! A!  @@ Aj ( ( @@ Aj (  (X! (  #A"6   A: ) @@ Aj  (  (P! (  #A"6   A: ( @@ Aj  (  ( (!  @@ Aj  (  (X! (  #A"6   A: & @@ Aj  (  (P! (  #A"6   A: % @@ Aj  (  (! (  #A"6   A: $ @@ Aj (  ( (! 6  A6 "   # #Aj # #Aj # #Aj # #Aj   A!  A! A!  A!  A!  @@@@@@@@@  6x 6t 6p ( #!  A AI ʀ! A"6| E    A:  @ AH (pM #! Aj AjA Aj #ـA"6   A:  @ AH #! Aj AjA Aj #ـA"6   A:  A! AJ  (x (t-6A!A! 6 A AK"6@  (p"M #! Aj AjA Aj #ـA"6   A:  @  G (xAj!  #"E  Aj$A!  Aj! (xAj! (t ("j! (p k!   A:  A!  A! 6 (D" 6 (<"  (PkAu"  I6#! ƀ! A"6 E   A :  6#! AjA! A" 6 E  A :  6 E  AA #A"6 E   A :  -AAq  (! (! #! Aj  ˀ! A" 6 E  A :  AG  @ (" A!  (6A! AI A!  (!#! ! A" 6 E   A :  @ (4"E ( A6 (d! A!A!  A! (`A: (d! A! @@@@@  6 (! (" Atj (" j-6 Ar"Atj  j-6 Ar"Atj  j-6 Ar"Atj  j-6@ Aj A|qG ("AqE  A|q!  #" E  Aj$A!  (Aj!   A:  A! At! A!@ (! ( j ( j j-6 Aj! Aj" AqG (! ( Atj!@ -AAqE Bۀ7 B7 Aj! @ -AA qE Bހ7@ B78 B݀ 70 B7( B7 B7 B7 B7 B 7 Aj! @ -@AqE A 6 Aj! @ -@AqE A 6 Aj! @ -@AqE A 6 Aj! @ -AAqE A"6 Aj! @ -@Aq A6 Aj! (@! (! A6@  (X!  #! (P"(! (!A AAA Aq AqjE  Aj! Aj! (!A! @@@@@@@  6 6 (@!#! (! (!     AAA Aq Aqj" ! A"6 E    A:  6@ A6 (AF #"E  Aj$A!  (@!#! (" (! (!A AAA Aq AqjE  Aj! Aj! (Aj!   A: A!  A! (X! A6#! ! A"6 E   A:  6@@ (4"E (" A6  @ AI A6  AtAr! 6 AA #A"6 E   A:  @ (" (`! (! A!  Aj! (X! (`!A!A! @@@@@@@@@@  6 6 6 6 (  (! ̀" 6 (! #!    k K ! A"6 E    A:  6@ AH ("  (" (" k (K" F @ j I A6    A! #A"6 E    A:  A! AJ  (Aj! A!@ (" (" AJ (O (A:A! (" AJ A! (Aj (O (! (A: (" AJ A! (Aj (O (! (A: (" AJ A! (Aj (O (! (A: (! @ AI  j (O (! ( j Av: Aj! (! @ AI  j (O (! ( j Av: Aj! (! @ AI  j (O (! ( j Av: Aj! (!  j (O  ( j :A! Aj! A!  6 6@ ( j" (I #! Aj AjA Aj #ـA"6   A: @ (AG ( j!  #"E  Aj$A!  Aj! ( ("j! ( j! (Aj! (Aj!   A:  A!  A! 6 (H! (@! A:@ E AqE (H 6 (!  #A"6   A:  A6 (d! (! A!  A!A! A! 6 6  #A"6   A: #Aj sA(" 6 #"Aj6  A‡j6  6  6  6  6  A:$  Aj   ~~@@@@@@ -$ (! (!#!  ! A"6 E    A:$  @@ Aj (   @@ Aj (   ( "(!  (Aq!@  (!@@@ E ɀ( Atj.AJ     @ ("Awj"AK A tAq  -A qE  A K A tAqE  ( " (6 Aj!  ("Aq! Aq! Aq! ( ! 4! B! B8! (AqA0G! @B " ! @@ P" P  !@@@ E @@@@@@@@@@ w   B܀ 7 B܀7 B܀ 7  B܀ 7  B܀7  B܀7  B܀ 7  B܀7  B܀7  B7 Aj!  @@ E ɀ( Atj.AL   E  AqA0F  6 A6  @@   Aq"A G  A6  AqA0r6  AvAqA0r6  AvAqA0r6 Aj!  @  A6 Aj! @@ Aq !  A6 Aj! @ E A6@ AG A?6   Aj6   6 A-6 Aj!   Bx|!     6  A6 #Aj sA," 6 #"AÇj6  Aćj6  6  6  6  6  A:(  Aj   ~@@@@@@@@@@ -( ("A F @ E (Avj @ ( ("A!H  A=F  AK  #! (!#! A遀j ! A"6 E    A:(  @@ Aj (   @@ Aj (   ( "(!  E  (! ( "A=6 #Aꁀj" AqAtj(6   AvA0]af8;i #!#!@@ (" ( AɅjF A偀j!A!  ( (("6#!@ A~L A!  A偀j!A ! ( !  6 6  #!@ ("( AɅjF #! ( !  A偀j6 A6  A!@ (((" AJ #! ( !  A灀j6 A6  ( 6A!  #!@@ ("( AɅjF #A偀j6A!A!  (($Aq!A! ( 6  #!@ ("( AɅjF #! ( !  A偀j6 A6  ("($!@ (((E  Ar6$A!   A~q6$A!  ("(! (((! A| (,"E  ( !   ! A"6, E    A:  @@ Ajo (, e @@ Ajo (, e (,"(!   (((! ("(! A| ( "E  ( !   ! A"60 E    A:  @@ Ajm (0 c @@ Ajm (0 c (0"(!   ("(! (((!A| (("E  ( !    ! A"64 E    A:  @@ Ajk (4 a @@ Ajk (4 a (4"(!  A! AF  ( ( (6 !  (((68 ("(! (!A| ("E  ( !    ! A"6< E    A:  @@ Ajh (< ^ @@ Ajh (< ^ (<"(!  A! AF  ("(!A| (,"E  ( ! (8!    ! A"6@ E    A:  @@ Ajf (@ \ @@ Ajf (@ \ (@"(!   ("(!A还 ("E  ( !   ! A"6D E    A:  @@ Ajd (D Z @@ Ajd (D Z (D"(!   ("(!A还 ( "E  ( !   ! A"6H E    A:  @@ Ajb (H X @@ Ajb (H X (H"(!   ("(!A还 ("E ~ ( !   ! A"6L E    A:  @@ Aj` (L V @@ Aj` (L V (L"(!   ("(!A还 ("E | ( !   ! A"6P E    A :  @@ Aj^ (P T @@ Aj^ (P T (P"(!   ("(!A还 ("E z ( !   ! A"6T E    A :  @@ Aj\ (T R @@ Aj\ (T R (T"(!  ~ (((! ("(! A| ("E x ( !   ! A"6X E }   A :  @@ AjZ (X P @@ AjZ (X P (X"(!  | ("(!A| ($"E v ( !   A! A"6\ E {   A : } @@ AjX (\ N (\A! z #! (((!#!  AߌjҀ! A"6` E    A : { @@ AjV (` L @@ AjV (` L (`"(!  6d E  B7#!  A Ӏ! A"6h E    A: y @@ AjT (h J @@ AjT (h J (h"(!  A! AF v#! (! #؀! A聀j À! A"6l E    A: w @@ AjR (l H @@ AjR (l H (l"(!  @ E A! u #!A! A"6p E    A: u @@ AjP (p F @@ AjP (p F (p"(!  E NA! A! A! ] @@ AjN ( D @@ AjN ( D ("(! A! \ @@ AjM ( C @@ AjM ( C ("(! A! [ @@ AjL ( B @@ AjL ( B (A! Z @@ AjK ( A @@ AjK ( A ("(!  E KA! Y @@ AjJ ( @ @@ AjJ ( @ ("(! A! X @@ AjI ( ? ( (! l @@ AjH ( > (d! ( Ԁ #A"6 E    A: l @@ AjG ( = @@ AjG ( = ( ("AG h #! ( " A⁀j6 A 6 f #! (((!#!  A䂀jҀ! A"6 E    A: h @@ AjC ( 9 @@ AjC ( 9 ("(!  6 E #! (! A ! AᅀjA"6 E    A: f @@ AjA ( 7 @@ AjA ( 7 ("(!  6 (! Ԁ #A"6 E    A: d @@ Aj? ( 5 @@ Aj? ( 5 ( ("AG ` #! ( " A぀j6 A 6 ^ #! (! (((! A ! AᅀjA"6 E    A: ` @@ Aj; ( 1 @@ Aj; ( 1 ("(!  AG \#! ( " A぀j6 A 6 [ #! (! (("(! (!   ! AᅀjA"6 E    A: ] @@ Aj8 ( . @@ Aj8 ( . ("(!  AG Y#! ( " A぀j6 A 6 X (((6 ("(!A还 ("E S ( !   ! A"6 E    A: Z @@ Aj5 ( + @@ Aj5 ( + ("(!  AF T ( ( (G 6A! V @@ Aj3 ( ) @@ Aj3 ( ) ("(! A! @ (((6 ("(!A还 ("E O ( !   ! A"6 E    A : V @@ Aj1 ( ' @@ Aj1 ( ' ("(!  AF O ( ( (G 4A! R @@ Aj/ ( % @@ Aj/ ( % ("(! A! ; ((("6#! ! A"6 E    A": R @@ Aj- ( # @@ Aj- ( # ("(!  6 ("(!A还 ("E I ( !   ! A"6 E    A#: P @@ Aj+ ( ! @@ Aj+ ( ! ("(!  AF H E @@ Aj) (  @@ Aj) (  ("(! A! E @@ Aj( (  @@ Aj( (  ("(! A! D ((("6#! ! A"6 E    A&: K @@ Aj& (  @@ Aj& (  ("(!  6 ("(!A还 ("E B ( !   ! A"6 E    A': I @@ Aj$ (  @@ Aj$ (  ("(!  AF = ; @@ Aj" (  @@ Aj" (  ("(! A! ; @@ Aj! (  @@ Aj! (  ("(! A! : (("("6 ("A6 ("6 (" 6 ( "6 (" 6 (" 6 ("6 ("6 ( "6 ($"6 (("6 ( !@ E E E E E E E E E E   #AɅjF #!A(! A"6 E    A*: D @@ Aj (  @@ Aj (  ("(!  E  (! B7 B7 B7  6  6  6  6#"A҅j! Aʅj! A˅j! A̅j! Aͅj! A΅j! Aυj! AЅj! AɅj! Aхj!  #AɅjG  ((!   #A̅jA"6   A+: A @@ Aj (  ( (A6 (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (" 6,  6(  6$  6  6  6  6  6  6  6 E E E E E E E E E E E A! < #! ( " A぀j6 A 6 : @@ Aj (  (A! : (("(6 (6 ("(!A还 ("E 4 ( !   ! A"6 E    A-: ; @@ Aj ( @@ Aj ( ("(!  AF + ( ( (G  , @@ Aj ( @@ Aj ( ("(! A!  (("(6 (("6#!@ ( A߁j!A! ' @ (" F ("AN   6#!@  F Aj! $ A၀j! % @@ Aj (  @@ Aj (  ("(!  ' @@ Aj (  ( @@ Aj (  (! (  #A"6   A2: 4 @@ Aj (  (! (  (Aj6A! 1 (("(! (6 E /#! 솀! A"6 E    A3: 2 @@ Aj  (  @@ Aj  (  ("(!  E . (((" (6  6A! . #! ( !  A݁j6 A6 ,   (!  #쀀A"6   A,: - # #A܂j # #A܂j # #A܂j # #A܂j # #A܂j # #A܂j # #A܂j   A! # A! A! A! A! A!  A!  A!  A!  A!  A! @@@@@  6 6#"E  Aj$A!  ((" ("F"  ("AI  Aj!   A4:  A! @@@@@@@  ("(!A还 ("E  ( !   ! A"6 E    A.:  AF #"E  Aj$A!  ( ( (F    A::  A!  A! @@@@@@@  ("(!A还 ( "E  ( !   ! A"6 E    A!:  AF #"E  Aj$A!  ( ( (G A!   A7:  A!  A! @@@@@@@  ("(!A还 ("E  ( !   ! A"6 E    A:  AF #"E  Aj$A!  ( ( (G A!   A6:  A!  A! @@@@@@@@@@@@@@@@@@@  6x 6| 6t (d!#!  A Ӏ! A"6 E   A: ' @ AG (|!A!  @ AH (" jAj-A G  Aj"jA: 6 (x! (t" O #! AxqAj! A"6 E   A: & @ A!A!  (AxqAj! 6 6 (!A" 6 #"A净j6  A懀j6  6  A: #" A"6 E   A: $ #! (!A(" A،j6 #"Aj6  Aj6  6  A:$ #" A"6 E   A: # ("(!A| (("E     ! A"6 E   A: " A! AG A! j(! 6  #A"6   A: #"E  Aj$A! (|Aj! (! (!   A5:  A!  A!  A!  A!  A!  A!  A!  6#!  Aj! 6 (AG A!  A၀j! A ! ( " 6  6 (!#! 솀! A"6 E   A/:  (! (! ( " 6 ("(6@ E (! ( (6 (! 6@  (" G  #A"6   A0:  ( ( " ("  F6  6  6 (!  #A"6   A1:  #! ( " A၀j6 A 6 A! ("E  ((((6 A! @@@@@@  (! (! ( (!#!   ! A"6 E    A(:  @  A! ("(!A还 ("E  ( !   ! A"6 E    A):  AF @@#"E Aj$   A9:  A!  A!  A! #! ( " A၀j6 A 6  A! @@@@@@  (! (! ( (!#!   ! A"6 E    A$: @  A! ("(!A还 ( "E  ( !   ! A"6 E    A%: AF @@#"E Aj$   A8: A!  A!  A! #! ( " A၀j6 A 6  #! ( " A၀j6 A 6  #! ( " A၀j6 A 6 A! 6  A6  6 (!  #A"6   A: # kA" 6( #"Aj6  Aj6  6$  6  6  A: #   k Aj! Aj! A j!@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ -:  "#$%&'(,.047:<>@BDFGIKMNPSWY[]^_`bmghijkl #! ($! ( " Aj6 A6@@@@@ S jLEA=/\`e7:h #!#!@@ ("( A䅀jF Aj!A!  ( (("6#!@ A~L A!  Aj!A ! ( !  6  6  #!@ ("( A䅀jF #! ( !  Aj6 A6  A!@ ((("AJ #! ( !  AÇj6 A6  ( 6A!  #!@@ ("( A䅀jF #Aj6A!A!  (($Aq!A! ( 6  #!@ ("( A䅀jF #! ( !  Aj6 A6  ("($!@ (((E  Ar6$A!   A~q6$A!  ("(! (((!A| (,"E  ( !    ! A"6, E    A:  @@ Ajn (, d @@ Ajn (, d (,"(!   (((! ("(!A| ( "E  ( !    ! A"60 E    A:  @@ Ajl (0 b @@ Ajl (0 b (0"(!   ("(! (((!A| (("E  ( !    ! A"64 E    A:  @@ Ajj (4 ` @@ Ajj (4 ` (4"(!  A! AF  ( ( (6 !  (((68 ("(! (!A| ("E  ( !    ! A"6< E    A:  @@ Ajg (< ] @@ Ajg (< ] (<"(!  A! AF  ("(!A| (,"E  ( ! (8!    ! A"6@ E    A:  @@ Aje (@ [ @@ Aje (@ [ (@"(!   ("(!A还 ("E  ( !   ! A"6D E    A:  @@ Ajc (D Y @@ Ajc (D Y (D"(!   ("(!A还 ( "E ~ ( !   ! A"6H E    A:  @@ Aja (H W @@ Aja (H W (H"(!   ("(!A还 ("E | ( !   ! A"6L E    A:  @@ Aj_ (L U @@ Aj_ (L U (L"(!   ("(!A还 ("E z ( !   ! A"6P E    A :  @@ Aj] (P S @@ Aj] (P S (P"(!  ~ ("(!A还 ("E x ( !   ! A"6T E }   A :  @@ Aj[ (T Q @@ Aj[ (T Q (T"(!  | (((! ("(!A| ("E v ( !    ! A"6X E {   A : } @@ AjY (X O @@ AjY (X O (X"(!  z ("(!A| ($"E t ( !   A! A"6\ E y   A : { @@ AjW (\ M (\A! x #! (((!#!  AߌjҀ! A"6` E    A : y @@ AjU (` K @@ AjU (` K (`"(!  6d E  B7#!  A Ӏ! A"6h E    A: w @@ AjS (h I @@ AjS (h I (h"(!  A! AF t#! (! #؀! A聀j À! A"6l E    A: u @@ AjQ (l G @@ AjQ (l G (l"(!  @ E A! s #!A! A"6p E    A: s @@ AjO (p E @@ AjO (p E (p"(!  E MA! A! A! [ @@ AjM ( C @@ AjM ( C ("(! A! Z @@ AjL ( B @@ AjL ( B ("(! A! Y @@ AjK ( A @@ AjK ( A (A! X @@ AjJ ( @ @@ AjJ ( @ ("(! A! W @@ AjI ( ? ( (! k @@ AjH ( > (d! ( Ԁ #A"6 E    A: k @@ AjG ( = @@ AjG ( = ( ("AG g #! ( " A뗀j6 A 6 e #! (((!#!  A䂀jҀ! A"6 E    A: g @@ AjC ( 9 @@ AjC ( 9 ("(!  6 E #! (! A ! AjA"6 E    A: e @@ AjA ( 7 @@ AjA ( 7 ("(!  6 (! Ԁ #A"6 E    A: c @@ Aj? ( 5 @@ Aj? ( 5 ( ("AG _ #! ( " AЁj6 A 6 ] #! (! (((! A ! AjA"6 E    A: _ @@ Aj; ( 1 @@ Aj; ( 1 ("(!  AG [#! ( " AЁj6 A 6 Z #! (! (("(! (!   ! AjA"6 E    A: \ @@ Aj8 ( . @@ Aj8 ( . ("(!  AG X#! ( " AЁj6 A 6 W (((6 ("(!A还 ("E R ( !   ! A"6 E    A: Y @@ Aj5 ( + @@ Aj5 ( + ("(!  AF S ( ( (G 5A! U @@ Aj3 ( ) @@ Aj3 ( ) ("(! A! ? (((6 ("(!A还 ("E N ( !   ! A"6 E    A: U @@ Aj1 ( ' @@ Aj1 ( ' ("(!  AF N ( ( (G 3A! Q @@ Aj/ ( % @@ Aj/ ( % ("(! A! : ((("6#! ƀ! A"6 E    A!: Q @@ Aj- ( # @@ Aj- ( # ("(!  6 ("(!A还 ("E H ( !   ! A"6 E    A": O @@ Aj+ ( ! @@ Aj+ ( ! ("(!  AF G D @@ Aj) (  @@ Aj) (  ("(! A! D @@ Aj( (  @@ Aj( (  ("(! A! C ((("6#! ƀ! A"6 E    A%: J @@ Aj& (  @@ Aj& (  ("(!  6 ("(!A还 ("E A ( !   ! A"6 E    A&: H @@ Aj$ (  @@ Aj$ (  ("(!  AF < : @@ Aj" (  @@ Aj" (  ("(! A! : @@ Aj! (  @@ Aj! (  ("(! A! 9 (("(" 6 ("A6 ("6 ("6 ( " 6 (" 6 ("6 ("6 ("6 ( "6 ($"6 (("6 ( !@ E E E E E E E E E E  #A䅀jF #!A(! A"6 E    A): C @@ Aj (  @@ Aj (  ("(!  E  (! B7 B7 B7  6  6  6  6#"A텀j! A兀j! A慀j! A煀j! A腀j! A酀j! Aꅀj! A녀j! A䅀j! A셀j!  #A䅀jG  ((!   #A煀jA"6   A*: @ @@ Aj (  ( (A6 (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (! (" 6,  6(  6$  6  6  6  6  6  6  6 E E E E E E E E E E E A! ; #! ( " A؜j6 A 6 9 @@ Aj (  (A! 9 (("(6 (6 ("(!A还 ("E 3 ( !   ! A"6 E    A,: : @@ Aj ( @@ Aj ( ("(!  AF * ( ( (G  + @@ Aj ( @@ Aj ( ("(! A!  (("(6 (("6#!@ ( A񃀀j!A! & @ (" F ("AN   6#!@  F Aj! # Aj! $ @@ Aj (  @@ Aj (  ("(!  & @@ Aj (  ( @@ Aj (  (! (  #A"6   A1: 3 @@ Aj (  (! (  (Aj6A! 0 (("(! (6 E .#瀀! ! A"6 E    A2: 1 @@ Aj  (  @@ Aj  (  ("(!  E , (((" (6  6A! - #! ( !  Aj6 A6 +   (!  #A"6   A+: , # #A܁j # #A܁j # #A܁j # #A܁j # #A܁j # #A܁j # #A܁j   A! " A! A! A! A!  A!  A!  A!  A!  A! @@@@@  6 6#"E  Aj$A!  ((" ("F"  ("AI  Aj!   A3:  A! @@@@@@@  ("(!A还 ("E  ( !   ! A"6 E    A-:  AF #"E  Aj$A!  ( ( (F    A9:  A!  A! @@@@@@@  ("(!A还 ( "E  ( !   ! A"6 E    A :  AF #"E  Aj$A!  ( ( (G A!   A6:  A!  A! @@@@@@@  ("(!A还 ("E  ( !   ! A"6 E    A:  AF #"E  Aj$A!  ( ( (G A!   A5:  A!  A! @@@@@@@@@@@@@@@@  6x 6| 6t (d!#!  A Ӏ! A"6 E   A: $ @ AG (|!A!  @ AH (" jAj-A G  Aj"jA: 6 (x! (t" O #!  AxqAj! A"6 E   A: # @  A!A!  (AxqAj! 6 6 (!A" 6 #"A净j6  A懀j6  6  A: #" A"6 E   A: ! ("(!A| (("E  (!    ! A"6 E   A: A! AG A! j(! 6  #A"6   A:  #"E  Aj$A!  (|Aj! (! (!   A4:  A!  A!  A!  A!  A!  6#!   Aj! 6 (AG A!  Aj! A ! ( " 6  6 (!#瀀! ! A"6 E   A.:  (! (! ( " 6  ("(6@ E (! ( (6 (! 6@  ("G  #A"6   A/:  ( ( " ("  F6  6  6 (!  #A"6   A0:  #! ( " Aj6 A 6 A! ("E  ((((6 A! @@@@@@  (! (! ( (!#؀!   À! A"6 E    A':  @  A! ("(!A还 ("E  ( !   ! A"6 E    A(:  AF @@#"E Aj$   A8:  A!  A!  A! #! ( " Aj6 A 6  A! @@@@@@  (! (! ( (!#؀!   À! A"6 E    A#: @  A! ("(!A还 ( "E  ( !   ! A"6 E    A$: AF @@#"E Aj$   A7: A!  A!  A! #! ( " Aj6 A 6  #! ( " Aj6 A 6  #! ( " Aj6 A 6 A! 6  A6  6 (!  #A"6   A: # [A" 6 #"Aj6  Aj6  6  A: #   Aj!@@@@@@@@@@ - (! ( ! A   #A"6 E    A:  @@ Aj (  @@ Aj (  ( A8" 6 #"Aj6  Aj6  A:4 #" A"6 E    A:  @@ Aj (  @@ Aj (  ( #Aj(!#!A" Aj6  Aj6 B7  6  A: #" A"6 E    A:  @@ Aj (  @@ Aj (  (  A6      # A  Aj   Aj  Aj  )AAAAԖAAAAŒxAAν~AAxAA˅LAAAAAAAAAA{AA񵢋~AA AAAA݌AAAA޺zAAԬAA͍AA١AA¢AA~AAݱAA}AAAA{AAAA˭AAyAAAAչAA~AAAAڊ{AAAAɀ|AAAAӄAAAA}AAyAAܐ{AA}AAџAAAAˆAAAAAĂxAAAA}AA{AAݠ|AA֑AAAAՑAAyAAAAAA|AAޗAAAAދAA|AAǒ|AAAAyAA՘|AA|AAЋzAA硖AA㓇AA}AAxAAAAAAyAATAAyAA鴬AAAAȭAA|AAAA߲AAAAAA~AAƒ{AAȰ~AAꠦAAyAA|AAAAxAA༮AAAAеxAAAAAA˹AAAAAAҮ2AA˩}AA糠yAAƷAAyAA|AAܠAAzAAπyAA|AAտAAAA|AA|AA[AA߯AAÉAAˆAAxAAAAҳ}AAyAAϗAAxAA|AAݡAAܹAA޽AAê~AAѢyAAаAAAAȟxAAȸ~AA}AAUAAxAA}AA鍶AA3AAyAA~AAAAԤ{AAAA~AA޺AAAAyAAAAAAAAα~AAAA按|AAAA䧥AAգAAAA׊}AA{AAzAAȢ~AA~AAAAAA씰{AA册xAAAAAA+AAAAAAϩAAAA%AAǝzAAϱ~AAxAAAAAAAAAA{AAAAzAAyAAθ|AAAAAAAAɲAAAAAAyAA{AA蕮AAʠAẢ|AA|AAAA{AAAA{AAԝAA⃽zAAǡxAAϺwAA׆AAɛAAԉAAAA}AAو~AAAAAAϒ}AAχAA˫{AA~AAAAěxAAвAAzAA}AAဝ~AAؠAAжAA{AAÖAAʯAAyAAAA~AAЊAAȶzAAíAAAAAAxAAAAפzAAAAϐ{AAAAAAAA{AAˆAAAA򄓅AAAAxAAAAɫzAAzAAAAyAAAA擷AAۚAAŧAAꠗ~AAֳ{AAˁ~AAɽzAA|AAAAAA~AA~AAՓ~AAAAyAAAAŬ{AAЖiAAyAAܥAAԽ{AAːCAAAA{AAAAȌAAAAAA|AA`AAzAAAAAAxAA}AAȭAA{AAAAԜAAϰ|AAAAzAAAAxAAץ}AAӊAA|AAAÂAAɑAA輖zAA|AAzAA0AAyAAAA~AAʄ{AAʩ|AAAAAAڒAAAAAAAAAAӷAAyAA䘟xAAzAAݲAAAAAAד~AAyAAAAAAAAAAƅAAÖzAA|AAAA|AAщ{AAʈAA{AA{AAAAAAè|AAAAAAAAAAڳ|AAAAAA%AA~AAtAAɲAA|AAAA񔣲AAҭzAAđ|AAʲAAAAӥzAAᡓyAAAAzAAͩzAAϣAAӽAAձAA߃AAͲ A AA|B#("AAB AA鼳B AAxB AAB AA|B AAB AA܅B AA还B  A dAA܅A#"Aj#("AAAԖ Aj AA|A Aj AA还AŒx Aj AA|Aν~ Aj AA܅Ax Aj AA|A˅L Aj AA܅A Aj AA鼳A Aj AA鼳Aπ Aj AA鼳Ay Aj AA~A Aj AA~A Aj AAA{ Aj AA~A񵢋~ Aj AA܅A Aj AA~A Aj AA鼳A݌ Aj AA܅A Aj AA还A޺z# AA|AԬ# AA|A͍# AA还A١# AA|A¢ Aj AA鼳A~ Aπj AA还Aݱ Aƀj AA还A} AՀj AA还A Aۀj AA还A{ Aހj AA还A Aကj AA还A˭ A䀀j AA还Ay A瀀j AA还A| Aj AA还A Aꀀj AA还Aչ A퀀j AA还A~ Aj AA还A A󀀀j AA还Aڊ{ Aj AA还A Aj AA还A} Aj AA还Ay Aj AA还A Aj AA还Aɀ| Aj AA还A Aj AA还Ax Aj AA还A̦x Aj AA还A Aj AA还Aӄ Aj AA还A Aj AA还A} Aj AA还Ay Aj AA还Aܐ{ Aj AA还A} Aj AA还Aџ Aj AA~A# AAȝїzAˆ Aj AA܅A# AAEA# AA܅Ăx# AA还A# AA܅A}# AA܅A{# AA|Aݠ| A遀j AA还A֑# AA|A# AA还AՑ# AA|Ay# AA鼳A# AA还A# AA还A|# AA还Aޗ Aj AA还A Aj AA还Aދ Aj AA还A| Aj AA还Aǒ| Aj AA还A Aj AA还A Aj AA还Ay Aj AA还A՘| Aj AA还A| Aj AA还AЋz Aj AA还A~ Aj AA还A Aj AA还Aȟ| Aj AA还A| Aj AA还Az Aj AA还A硖 Aj AA还A㓇 Aj AA还A} Aj AA还Ax Aj AA鼳A Aj AA܅A Aԁj AA鼳Ay Aj AA|AT Aj AA|Ay Aj AA|A鴬 Aj AA鼳A Aj AA܅Aȭ AƂj AA܅A| Aɂj AA܅A Aρj AA܅A߲ A΂j AA|A Aтj AAA AԂj AAA~ Aׂj AAAƒ{ Aڂj AA还AȰ~ Aۂj AA还Aꠦ Aj AA|Ay Aむj AAA| A炀j AAA A䂀j AA~Ax A삀j AA鼳A༮ Aj AA܅A A򂀀j AA܅Aеx Aj AA܅A AЁj AA܅A Aj AA还A˹ Aj AA|A Aj AAA Aj AAAҮ2 Aj AA~A˩} Aj AA还A糠y# AA|AƷ Aj AA还Ay# AA|A| Aj AA鼳Aܠ Aj AA还Az Aj AA还Aπy Aj AA|A|# AA鼳Aտ Aj AA还A Aj AA还A| Aj AA|A| Aj AA鼳A AÁj AA鼳Az Aāj AA鼳A[ Aj AA还A߯ Aj AA܅AÉ Aҁj AA|Aˆ# AA还Ax# AA܅A Aƃj AA܅Aҳ} AɃj AA还Ay# AA还Aϗ Aσj AAAx Aj AAA| Aj AA܅Aݡ Àj AA܅Aܹ AҀj AA܅A޽ Aj AA܅Aê~ Aj AA܅AѢy A؀j AA|Aа A냀j AA܅A A҃j AA鼳Aȟx Aj AA܅Aȸ~ AӁj AA还A} Aj AA还AU Aj AA܅Ax Aj AA还A} Aj AA还A鍶 Aj AA还A3 Aj AA还Ay Aj AAA~ Aj AA鼳A AŁj AA܅AԤ{ AՁj AA܅A Aj AA܅A~ Aj AA܅A޺ Ãj AA鼳A Aj AA还Ay Aj AA܅A A΁j AAA Aj AA܅A Aj AA|Aα~ A䁀j AA܅A Aj AA鼳A按| Aj AA|A Aꃀj AA鼳A䧥 Aj AA还Aգ Aj AA|A A؃j AAA׊} Aރj AA|A{ AჀj AAAz Aۃj AA|AȢ~ A䃀j AA܅A~ Aj AA܅A Aɀj AA|A A၀j AA~A씰{ Aj AA还A册x Aj AA|A Aj AA܅A Aj AA|A+ Aj AA|A Aj AA|A Aj AA|Aϩ Aj AA|A Aj AA鼳A% Aj AA|Aǝz Aj AA|Aϱ~ Aсj AA鼳Ax Aꁀj AA鼳A Aˁj AA鼳A Aj AA鼳A Aj AA|A Aj AA还A{ Aj AA还A Aj AA还Az Aj AA还Ay Aj AA还Aθ| A„j AA还A Ańj AA还A AȄj AA还A A˄j AA还Aɲ A΄j AA还A Aфj AA还A AԄj AA还Ay Aׄj AA还A{ Aڄj AA还A蕮 A݄j AA还Aʠ Aj AA还Ả| A㄀j AA还A| A愀j AA还A A鄀j AA还A{ A섀j AA还A Aj AA还Aױķ Aj AA还A Aj AA还A{ A򄀀j AA还Aԝ Aj AA还A⃽z Aj AA还Aǡx Aj AA还AϺw Aj AA还A׆ Aj AA还Aɛ Aj AA还Aԉ Aj AA还A Aj AA还A} Aj AA还Aو~ Aj AA还A Aj AA还A Aj AA还Aϒ} Aj AA还Aχ Aj AA还A˫{ Aj AA还A~ Aj AA还A Aj AA还Aěx Aj AA还Aв Aj AA还Az Aj AA还A} Aj AA还Aဝ~ Aj AA还Aؠ Aj AA还Aж Aj AA|A{#䀀 AA鼳AÖ# AA鼳Aʯ# AA܅Ay# AA~A#倀 AA~A~# AA鼳AЊ#怀 AA܅Aȶz#耀 AA~Aí#退 AA~A#ꀀ AAA#뀀 AA还A몝| AɅj AA还A~ Aхj AA还A AЅj AA还A{ Aυj AA还AȠy A΅j AA|Ax Aͅj AA|A A̅j AA|Aפz A˅j AA|A Aʅj AA|Aϐ{ A҅j AA܅A#쀀 AA|A Aᅀj AAA# AA还A| A䅀j AA还A߁{ A셀j AA还Aښ A녀j AA还Aٰ{ Aꅀj AA还Ax A酀j AA|A{ A腀j AA|Aˆ A煀j AA|A A慀j AA|A򄓅 A兀j AA|A A텀j AA܅Ax# AA|A Aj AA鼳Aɫz#񀀀 AA还Az#􀀀 AA还A# AAyAy# AA鼳A Aj AA还A擷 Aj AAɯAۚ# AA٪yAŧ# AA还Aꠗ~# AA还Aֳ{# AA܅Aˁ~# AAAɽz# AA鼳A|# AAA# AAA# AA|A~ Aj AA还A~ Aj AA鼳AȠ Aj AA还AՓ~ Aj AA还A Aj AA还Ay# AA鼳A߇x Aj AA鼳A# AA还AŬ{ Aj AAAЖi# AA|Ay# AA鼳Aܥ# AA还AԽ{# AA还AːC# AA还A# AA|A{# AA鼳A# AA鼳AȌ# AA܅A# AA鼳A# AAA|# AA还A`# AA鼳Az#Ɂ AA鼳A#ʁ AA还A#ˁ AA|Ax#́ AAA}#́ AAAȭ#΁ AAA{#ρ AAA#Ё AAAԜ#с AAAϰ|#ҁ AA|A#Ӂ AA鼳Az#ԁ AA还A#Ձ AA还Ax#ց AAAץ}#ځ AA还Aӊ#ہ AA还A|#܁ AAA#݁ AA鼳Â#ށ AA鼳Aɑ#߁ AA还A輖z# AA|A|#၀ AA还Az Aj AAA0#぀ AA|Ay#偀 AAA#恀 AAA~#灀 AAAʄ{#聀 AA还Aʩ|#遀 AA鼳A#ꁀ AA鼳A#끀 AA还Aڒ#쁀 AA鼳A#큀 AA还A# AA|A# AA还A# AA|Aӷ#񁀀 AA|Ay#򁀀 AA还A䘟x#󁀀 AA还Az#􁀀 AAAݲ# AA还A# AAA# AAAד~# AAAy# AA܅A# AAA# AAA# AA܅A AƁj AA܅Aƅ Aցj AA܅AÖz A烀j AA~A| AՃj AA还A Aj AAA|# AAEAщ{ Aj AAAʈ Aj AAA{ Aj AAA{ Aj AA~A# AA~A# AAAè|# AAA# AA~A# AAEA# AA~A#⁀ AAAڳ|# AA|A# AA~A# AA|A%# AA~A~# AAAt# AA~Aɲ# AA~A|# AA~A# AA|A񔣲# AA还Aҭz# AA|Ađ|# AAA̴ Aj AAA Aj AAȏ|Aʲ A뇀j AA|A Aj AAȏ|Aӥz A񇀀j AAȏ|Aᡓy A􇀀j AAȏ|A Aj AA|Az# AA|Aͩz# AA|Aϣ# AA|Aӽ# AA~Aձ# AA~A߃# AA|AͲ#  $ #  @#  *?_-.[]~= : \e[8~\e[7~\e[4~\e[3~\e[2~\e[1~tty_sttynode__tryed_search_prev_historyed_search_next_historyrl_get_previous_historystifle_history%s/.historycan't write historyixanyvtdlybsdlycrdlynldlyffdlytabdlymap_print_keyre_clear_displaystrnunvisxistrsenvisxl->l_idx > (size_t)idxhistory_wct_decode_argvvi_kill_line_prevem-inc-search-prevkulnextno inputbegin standoutend standoutoposthistory_listfn_display_match_listempty listechoprtrl_inserted_insertc_inserted-quoted-insertstartrl_set_promptkeymacro_kprintreprintprompt_printkeymacro_printbrkintget_history_eventno next eventno previous eventfunction not allowed with other history-functions-set the defaultquittty_initread_initvi_histeditsends cursor rightsends cursor lefthistory_def_setonlrethist_getkeymacro_gethistory_arg_extractmap_print_some_keysusnoedit_wgetsel_wgetsel_getsc_getscrtsctsbad parametersterminal_deletecharsinsert multiple charsdelete multiple charsc_hposhistory_search_poscursor to horiz posunvisch_enlargebufsyeshistory_total_bytesend attributesre_clear_linesrl_completion_matchesemacsxtabshas%-*s %*s%s%s%s%s/%sel_winsertstrel_wreplacestrkeymacro__decode_strintrre_refresh_cursorhome cursorunknown errorkrhistory_def_enterc_delafterinsert characterdelete a characterEditLine wrapper%s: Bad word specifierterminal_alloc_bufferSome extended keys too long for internal print bufferonocrigncronlcrinlcrignparterminal_move_to_char_rl_event_read_chared-delete-next-charliteral_clearhistory_def_clearsends cursor uprl_tstpsusptostopistriphistory_save_fpsonoflushoechocoxnsends cursor downixonicanonusername_completion_functionfn_filename_completion_functionReadLine compatible completion functionReadLine compatible suspend functionem_copy_regionem_kill_regionminpendiniextenolen + clen < maxolenclear screennode_enumre_goto_bottomclear to bottomkmimdmamechoctleolocrnlicrnlechonlkillofillvisible bellaudible bellklofdelhistory_def_delimaxbeldlhupclblre_putliteralclocalparmrkignbrkechokem_yankinpckvilieiclen < 0 || (size_t)clen <= mbslengthnoflshre_refreshkhvi_matchcv_csearchhistory_searchce_inc_searchct_visual_stringct_encode_stringparse__stringinsert paddingisiged_move_to_beged-move-to-begeofixoffterminal_change_sizehistory_tokenizehistory size negativedoes not haveueterminal_insertwriteterminal_overwriterl_completenode__deletesend cursor deletewerasexcaseem_lower_caseem_upper_caseem_capitol_casevi_change_casec_delbeforeechoecursor up onetok_wlinebegin underlineend underlineed_prev_lineed_next_lineterminal_move_to_lineem_kill_lineed_kill_lineel_linetok_linece_search_linecursor to status linecursor from status lineadd new blank lineclear to end of linedelete a linesend cursor hometimecursor right multiplecursor left multiplecursor up multiplecursor down multiplehistory_truncate_filecan't read history from fileechoketty_rawmodetty_noquotemodetty_quotemodetty_cookedmodestart insert modeend insert modestart delete modeend delete modeel_sourcenon destructive spacecibaudcbaudcv__endwordvi_history_wordem_copy_prev_wordcv_prev_worded_delete_prev_wordc__prev_wordcv_next_wordem_delete_next_wordc__next_worded-prev-wordem-next-worddiscardfirst event not foundlast event not foundmap_bindhistory_wendtty_endhistory_endliteral_endterminal_endread_ended-move-to-endsend cursor endhistory_expandhist_commandparse_cmdbegin boldkdcurrent event is invalidmalloc() failedrequired parameter(s) not suppliedparoddliteral_addcdcread%dolcucre_fastputcre_putcterminal_settcterminal_gettcterminal_echotcel_wgetcextprocterminal_allociuclcicdc../../libedit-20230828-3.1/src/tty.c../../libedit-20230828-3.1/src/vis.c../../libedit-20230828-3.1/src/literal.cvbcstopbparenbdumbmap_init_meta^Zclen <= MB_LEN_MAXMT^REDITORUPDOTERMterminal_clear_EOLidx & EL_LITERALOK^IRI\e[H\e[F0123456789ABCDEFHOMELEkD\e\e[D\e[5D\e[1;5D\e\e[CEDITRCICDC\e[5C\e[1;5C*[]?chars:oflag:lflag:iflag:cflag:^*$-0123456789history_def_del.729@7history_def_enter.727history_def_clear.726history_def_set.725__udivmodti4eol2fn_complete2el_deletestr1c_delafter1c_delbefore1c != -1history_save_fp.750c != 0./r+(empty)const char *literal_get(EditLine *, wint_t)int tty_stty(EditLine *, int, const wchar_t **)int istrsenvisx(char **, size_t *, const char *, size_t, int, const char *, int *)"'()<>;&|$:^*$'`"""not %c%s Display all %zu possibilities? (y or n) It has %s meta key It %s automatic margins It %s magic margins %-4s to %-7s-> %ls %-15s-> %ls %s -> %ls %ls %ls Arrow key bindings Alternative key bindings Standard key bindings Multi-character bindings It has %d columns and %d lines It can%suse tabs %25s (%s) == %s %d %s Your terminal has the %s: Event not found keymacro_add: sequence-lead-in command not allowed %-15s-> is undefined Cannot read termcap database; No entry for terminal type "%s"; echotc: Warning: Missing argument. echotc: Bad value `%ls' for rows. echotc: Bad value `%ls' for cols. using dumb terminal settings. %ls: Invalid \ or ^ in outstring. %ls: Invalid \ or ^ in instring. Out of termcap string space. echotc: Termcap parameter `%ls' not found. keymacro_delete: Null extended-key not allowed. keymacro_add: Null extended-key not allowed. echotc: Warning: Too many required arguments (%d). %s: Invalid argument `%ls'. echotc: Warning: Extra argument `%ls'. edit: Bad value `%ls'. %ls: Invalid command `%ls'. %ls: Bad capability `%s'. %ls: Bad value `%s'. %s: Unknown switch `%lc'. %ls: Invalid switch `%lc'. echotc: Warning: unknown termcap %% `%c'. Unbound extended key "%ls" "%ls..." following characteristics: /.editrconofflistsizeunique%-15s-> %s , ! "  &'0*  " +)/ +)/    A*8 CNLT_MS32I6 ;JX@PHRVZ\D^ >1K59<=;|&{(/tmp/.historyXXXXXX0123456789abcdef#$@[\]^`{|}~0123456789ABCDEFAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt8P>>3>L?X?0@=`@@>AALATB!BC CD0DHE'|E(F(dFDGG@H$HLI+IJ/QT~WZ rjj*kk=8k!Tk$lk1? g6 R I -O ]I^ j x| Z S LH 1 ,(,,a! n S  nh  L I    l  # yesnowi ~pbw@i ~pbaw@i~pbqzj @g A N @+ @ @{Lc @  b x @~ ~@ c  @2 y V] z} nnn4ooo pDppp0qqqrrsHe { / X p!^ =( "\'`@$><=;|&{(d   A    $(,048<@DHLP $  $(    $(,0   $(,0#  $(048<&   $(048n048<,048@  (,04 $,48<@DH$(,DHLhl , $()  $/   $(0482  $(,5 8  $(048:< $(>  $(   $08<HTX\  , (  (,048 (,DHLTX\`dhptx| $$,0Kr 048<HP\`l|  $(,048<@DHLPT`dhptx  $(,4<@DHPTX\`dhlE ]  $(Y y  $(,048<@ C $(,48<Q E H $(@  (048<@HN ,48@W 04@DT  $(04Z  $] ` c f i l o u x r $({ ~   $(,DHL   $(,04<@DHPTX`d   $( 048<@HLPTX`  ,048<@DL   $(048@DHLPTX\`  $048<@HLPTX  $,    (,048    $(,048  $(8<@DHPX  $(,0 TX\`dhlptx0$ $(08@DHPThpx|  $(,0<@DL (,4 $( $(,048<@DHLPTX\`dhlptx#  $(,048<@DHLPTX\dhlpx|  048<DHLP   $(,048<@DH      $-048DHLPTX\`dltx| $(,0?    (,4  $(,04<@DPTX`hlpt|   $  $(,  $(,048  (048<@ Q (,048<@DHLPTX\`dhlpx  $(,048<@DHLTX\`dhlptx|<" $,048<@DHPT\`dhtx   $(,)3  $(,048<@DHLPTX\`dhlptx|H V  $(,48<@DHLS  $(v(4|  048<@DHLPTX\`dhlptx|t   $(  $(,04k 08<@LPT (,08<@DHLPi  $(,048<@DHf  $(b  $(,     $(,0_   $(  $(,048  *   ( , 0 8 < @ L T X ` d h p t x |   $(,08<@DHLPTX\   $(,  $   $(048<@DHLPTX\`dhlptx  $(,048<@D  $(C q    $(08<@      Y V   $(,048<@}  S P        =  9 6  3  D  A  ,04@DLX 48w z  M _   $(048<@DHLP!,048<DHLPTX\`dhlpx|n k t h  \ J G  e b     &   $(,/.,048<@DHPTX\`dhlpx|2 , 5     $  $)  $(# q  $(,048,  $( 8     (,     $   %  $(,048<@DHLPTX\dhlptx| @HTX\dlptx  (,M K  .  :    $(,048<@DHLPT ,048<@DHLPTX\`dhlp  (  $(048<@DHPTX`lpt   P   $  $(,048<@DHLPTX\`dhlpx| $,  ,048<HLT  ( $,    $(&  $(,048<@D   $(,048   $(48<@DLT  $(,0   $(,  $(,048  (048<@     $  $(,048<@DHLTX\`dltx|$  $(,048<@DHLPTX\`dhlpt|  $(,48<@P`dhl     (,048<@LPTX\`dh >  (,04<@DLPTX`dptx|$(,08<@LPX`  (,048  7  $(,048<@DHLPTX\`dhltx|  $(,0 $(,04<@DPT\dhlpx3P (,048<@DHLPTX\`dhlpx  $(,048<@DHPTX\`dhlptx|  $ $,048@DHLPTX\`dp- ' % lLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx| +  $(,048<)5 $,00 $(,048<@DHLPTX7; $,48<DH=(,049 $4<LPT`dhptx|? E  (,48DHLTX`dhC,48<HLT\`dhAu $(,048<@H`dhltx|  $(,048DHLTX\`hlp|$,04<@HPX`dhpt|G $K $(,04I  $(,0MO$ 8<@HLPTX\dhltx|Q  $(048<@S  $(048U$(,08<@DHPTW$(,04<DHLPTXY [ (]_(04a$c$e$,048g i k   $(,mqos u w y ~   {  $(048 $(,0     $(  $  $(,0   $ PTX\`dhlpt (,08<@DHT\dhl         $ (,  $ $(,  $ (, (,0 ( $(    ( (,   hwjs.abiMԖnamelibedit.so.0.0.72 __hwjs_frame_alloc__hwjs_frame_publish__hwjs_set_parkediswalnumiswgraphiswspaceiswdigitiswcntrliswprint wcwidth __hwjs_drive_abi __hwjs_promise_i32 __hwjs_budget_not_refilled __hwjs_promise_i64__hwjs_promise_a16__hwjs_register_suspends__hwjs_register_capsummary__hwjs_register_fpcast_adapter__hwjs_budget_set__hwjs_budget_get__hwjs_budget_uninitialized__hwjs_clear_parkedmemcpy__hwjs_take_parked__hwjs_xfer_descend hwjs_lj_matchhwjs_lj_unwound hwjs_destroy__hwjs_xfer_return__hwjs_frame_free hwjs_traprealloc memset!__hwjs_xfer_park"__hwjs_xmod_dispatch_check#wcschr$wcrtomb%wctomb&fputc'tgoto(tputs)fputs* __assert_fail+__hwjs_noreturn_completed,fflush-calloc.free/wcslen0mbstowcs1malloc2abort3fprintf4 tcgetattr5__errno_location6 cfgetispeed7 cfgetospeed8 cfsetispeed9 cfsetospeed: tcsetattr;wcsncpy<wcsstr=regcomp>regexec?regfree@wcsncmpAwmemcpyBstrlcpyCstrncmpDstrcmpEffsFstrlenGstrcpyH__isoc23_strtolI __ctype_b_locJmbrtowcK mbsrtowcsL__ctype_get_mb_cur_maxM__ctype_tolower_locNfilenoOfchmodPftellQwcscmpRfopenS __getdelimTfcloseU__isoc23_wcstolVtgetstrWwcstombsX sigemptysetY sigaddsetZ sigprocmask[getenv\tgetent]tgetflag^tgetnum_ioctl`strchrawcscspnbmkstempcwritedforkeclosefexeclpgexithunlinkiwaitpidjlseekkreadliswuppermtowlowerniswlowerotowupperpwctobqiswalpharisattys sigactiontkillufcntlv secure_getenvwsnprintfxstrdupygetuidz getpwuid_r{ getpwnam_r|strrchr}closedir~opendirreaddir strcasecmpstatqsortgetcmemmovehwjs_sj_record hwjs_lj_clear hwjs_lj_valuestrstrgetpwuidfdopenfreadferrorfwritefseekoftello ftruncatesetpwentgetpwentendpwenthwjs_lj_arm_fromstrcoll vsnprintf__wasm_call_ctors__wasm_apply_data_relocs__wasm_init_memorycv_undocv_undo.destroycv_undo.resumecv_yankcv_yank.destroycv_yank.resumec_insertc_insert.destroyc_insert.resumech_enlargebufsch_enlargebufs.destroych_enlargebufs.resume c_delafterc_delafter.destroyc_delafter.resume c_delafter1c_delafter1.destroyc_delafter1.resume c_delbeforec_delbefore.destroyc_delbefore.resume c_delbefore1c_delbefore1.destroyc_delbefore1.resume ce__iswordce__isword.destroyce__isword.resume cv__isword cv__isWord c__prev_wordc__prev_word.destroyc__prev_word.resume c__next_wordc__next_word.destroyc__next_word.resume cv_next_wordcv_next_word.destroycv_next_word.resume cv_prev_wordcv_prev_word.destroycv_prev_word.resume cv_delfinicv_delfini.destroycv_delfini.resume cv__endwordcv__endword.destroycv__endword.resumech_initch_init.destroych_init.resumech_endch_end.destroy ch_end.resume el_winsertstrel_winsertstr.destroyel_winsertstr.resume el_deletestrel_deletestr.destroyel_deletestr.resume el_deletestr1el_deletestr1.destroyel_deletestr1.resumeel_wreplacestrel_wreplacestr.destroyel_wreplacestr.resume el_cursorc_getsc_gets.destroy c_gets.resumec_hposc_hpos.destroy c_hpos.resumeed_end_of_fileed_end_of_file.destroyed_end_of_file.resume ed_inserted_insert.destroyed_insert.resumeed_delete_prev_worded_delete_prev_word.destroyed_delete_prev_word.resumeed_delete_next_chared_delete_next_char.destroyed_delete_next_char.resume ed_kill_lineed_kill_line.destroyed_kill_line.resumeed_move_to_ended_move_to_end.destroyed_move_to_end.resumeed_move_to_beged_move_to_beg.destroyed_move_to_beg.resumeed_transpose_chars ed_next_chared_next_char.destroyed_next_char.resume ed_prev_worded_prev_word.destroyed_prev_word.resume ed_prev_chared_prev_char.destroyed_prev_char.resumeed_quoted_inserted_quoted_insert.destroyed_quoted_insert.resumeed_digited_digit.destroyed_digit.resumeed_argument_digit ed_unassigned ed_ignore ed_newlineed_newline.destroyed_newline.resumeed_delete_prev_chared_delete_prev_char.destroyed_delete_prev_char.resumeed_clear_screened_clear_screen.destroyed_clear_screen.resume ed_redisplay ed_start_overed_sequence_lead_ined_prev_historyed_prev_history.destroyed_prev_history.resumeed_next_historyed_next_history.destroyed_next_history.resumeed_search_prev_historyed_search_prev_history.destroyed_search_prev_history.resumeed_search_next_historyed_search_next_history.destroyed_search_next_history.resume ed_prev_lineed_prev_line.destroyed_prev_line.resume ed_next_lineed_next_line.destroyed_next_line.resume ed_commanded_command.destroyed_command.resumeel_initel_init.destroyel_init.resumeel_init_internalel_init_internal.destroyel_init_internal.resumeel_endel_end.destroy el_end.resume el_init_fdel_init_fd.destroyel_init_fd.resumeel_resetel_reset.destroyel_reset.resumeel_wline el_sourceel_source.destroyel_source.resume el_resizeel_resize.destroyel_resize.resumeel_beepel_beep.destroyel_beep.resume el_editmodeel_editmode.destroyel_editmode.resumeel_getcel_getc.destroyel_getc.resumeel_pushel_push.destroyel_push.resumeel_getsel_gets.destroyel_gets.resumeel_parseel_parse.destroyel_parse.resumeel_lineel_line.destroyel_line.resume el_insertstrel_insertstr.destroyel_insertstr.resume el_replacestrel_replacestr.destroyel_replacestr.resumeem_delete_or_listem_delete_or_list.destroyem_delete_or_list.resumeem_delete_next_wordem_delete_next_word.destroyem_delete_next_word.resumeem_yankem_yank.destroyem_yank.resume em_kill_lineem_kill_line.destroyem_kill_line.resumeem_kill_regionem_kill_region.destroyem_kill_region.resumeem_copy_regionem_copy_region.destroyem_copy_region.resumeem_gosmacs_transpose em_next_wordem_next_word.destroyem_next_word.resume em_upper_caseem_upper_case.destroyem_upper_case.resumeem_capitol_caseem_capitol_case.destroyem_capitol_case.resume em_lower_caseem_lower_case.destroyem_lower_case.resume em_set_markem_exchange_markem_universal_argument em_meta_nextem_toggle_overwriteem_copy_prev_wordem_copy_prev_word.destroyem_copy_prev_word.resumeem_inc_search_nextem_inc_search_next.destroyem_inc_search_next.resumeem_inc_search_prevem_inc_search_prev.destroyem_inc_search_prev.resumeem_delete_prev_charem_delete_prev_char.destroyem_delete_prev_char.resume hist_inithist_init.destroyhist_init.resumehist_endhist_end.destroyhist_end.resumehist_gethist_get.destroyhist_get.resume hist_converthist_convert.destroyhist_convert.resume hist_commandhist_command.destroyhist_command.resumehist_enlargebufhist_enlargebuf.destroyhist_enlargebuf.resume keymacro_initkeymacro_init.destroykeymacro_init.resume node__putnode__put.destroynode__put.resumekeymacro_resetkeymacro_reset.destroykeymacro_reset.resume keymacro_endkeymacro_end.destroykeymacro_end.resume node__freenode__free.destroynode__free.resume keymacro_getkeymacro_get.destroykeymacro_get.resume keymacro_addkeymacro_add.destroykeymacro_add.resume node__trynode__try.destroynode__try.resumekeymacro_clearkeymacro_clear.destroykeymacro_clear.resume node__deletenode__delete.destroynode__delete.resumekeymacro_deletekeymacro_delete.destroykeymacro_delete.resumekeymacro_printkeymacro_print.destroykeymacro_print.resume node_enumnode_enum.destroynode_enum.resumekeymacro_kprintkeymacro_kprint.destroykeymacro_kprint.resumekeymacro__decode_strkeymacro__decode_str.destroykeymacro__decode_str.resumemap_initmap_init.destroymap_init.resume map_init_vimap_init_vi.destroymap_init_vi.resume map_init_metamap_init_meta.destroymap_init_meta.resumemap_endmap_end.destroymap_end.resumemap_init_emacsmap_init_emacs.destroymap_init_emacs.resumemap_set_editormap_set_editor.destroymap_set_editor.resumemap_bindmap_bind.destroymap_bind.resumemap_print_some_keysmap_print_some_keys.destroymap_print_some_keys.resume map_print_keymap_print_key.destroymap_print_key.resume map_addfuncmap_addfunc.destroymap_addfunc.resumect_encode_stringct_encode_string.destroyct_encode_string.resumect_encode_charct_encode_char.destroyct_encode_char.resumect_decode_stringct_decode_string.destroyct_decode_string.resumect_decode_argvct_decode_argv.destroyct_decode_argv.resume ct_enc_widthct_enc_width.destroyct_enc_width.resumect_visual_stringct_visual_string.destroyct_visual_string.resumect_visual_char parse_lineparse_line.destroyparse_line.resume el_wparseel_wparse.destroyel_wparse.resume parse__escapeparse__escape.destroyparse__escape.resume parse__stringparse__string.destroyparse__string.resume parse_cmdparse_cmd.destroyparse_cmd.resume prompt_printprompt_print.destroyprompt_print.resumeprompt_defaultprompt_default_r read_initread_init.destroyread_init.resume read_charread_char.destroyread_char.resumeread_endread_end.destroyread_end.resumeel_wpushel_wpush.destroyel_wpush.resumeel_wgetcel_wgetc.destroyel_wgetc.resume read_prepareread_prepare.destroyread_prepare.resume read_finishread_finish.destroyread_finish.resumeel_wgetsel_wgets.destroyel_wgets.resume noedit_wgetsnoedit_wgets.destroynoedit_wgets.resume re_putliteralre_putliteral.destroyre_putliteral.resumere_putcre_putc.destroyre_putc.resume re_refreshre_refresh.destroyre_refresh.resumere_goto_bottomre_goto_bottom.destroyre_goto_bottom.resumere_clear_displayre_clear_display.destroyre_clear_display.resumere_refresh_cursorre_refresh_cursor.destroyre_refresh_cursor.resume re_fastaddcre_fastaddc.destroyre_fastaddc.resume re_fastputcre_fastputc.destroyre_fastputc.resumere_clear_linesre_clear_lines.destroyre_clear_lines.resume search_initsearch_init.destroysearch_init.resume search_endsearch_end.destroysearch_end.resumeel_matchel_match.destroyel_match.resumec_hmatchc_hmatch.destroyc_hmatch.resumec_setpatc_setpat.destroyc_setpat.resume ce_inc_searchce_inc_search.destroyce_inc_search.resumece_search_linece_search_line.destroyce_search_line.resume cv_searchcv_search.destroycv_search.resumecv_repeat_srchcv_repeat_srch.destroycv_repeat_srch.resume cv_csearchcv_csearch.destroycv_csearch.resumesig_initsig_init.destroysig_init.resumesig_endsig_end.destroysig_end.resumesig_setsig_set.destroysig_set.resume sig_handlersig_handler.destroysig_handler.resumesig_clrsig_clr.destroysig_clr.resume terminal_initterminal_init.destroyterminal_init.resume terminal_setterminal_set.destroyterminal_set.resume terminal_endterminal_end.destroyterminal_end.resumeterminal_allocterminal_alloc.destroyterminal_alloc.resumeterminal_setflagsterminal_setflags.destroyterminal_setflags.resumeterminal_change_sizeterminal_change_size.destroyterminal_change_size.resumeterminal_bind_arrowterminal_bind_arrow.destroyterminal_bind_arrow.resumeterminal_alloc_bufferterminal_alloc_buffer.destroyterminal_alloc_buffer.resumeterminal_move_to_lineterminal_move_to_line.destroyterminal_move_to_line.resume terminal_putcterminal_putc.destroyterminal_putc.resumeterminal__putcterminal__putc.destroyterminal__putc.resumeterminal_move_to_charterminal_move_to_char.destroyterminal_move_to_char.resumeterminal_overwriteterminal_overwrite.destroyterminal_overwrite.resumeterminal_deletecharsterminal_deletechars.destroyterminal_deletechars.resumeterminal_insertwriteterminal_insertwrite.destroyterminal_insertwrite.resumeterminal_clear_EOLterminal_clear_EOL.destroyterminal_clear_EOL.resumeterminal_clear_screenterminal_clear_screen.destroyterminal_clear_screen.resume terminal_beepterminal_beep.destroyterminal_beep.resumeterminal_get_sizeterminal_get_size.destroyterminal_get_size.resumeterminal_set_arrowterminal_set_arrow.destroyterminal_set_arrow.resumeterminal_clear_arrowterminal_clear_arrow.destroyterminal_clear_arrow.resumeterminal_print_arrowterminal_print_arrow.destroyterminal_print_arrow.resumeterminal__flushterminal__flush.destroyterminal__flush.resumeterminal_writecterminal_writec.destroyterminal_writec.resumeterminal_telltcterminal_telltc.destroyterminal_telltc.resumeterminal_settcterminal_settc.destroyterminal_settc.resumeterminal_gettcterminal_gettc.destroyterminal_gettc.resumeterminal_echotcterminal_echotc.destroyterminal_echotc.resumetty_inittty_init.destroytty_init.resume tty__getchar tty_bind_chartty_bind_char.destroytty_bind_char.resumetty_endtty_end.destroytty_end.resume tty_rawmodetty_rawmode.destroytty_rawmode.resumetty_cookedmodetty_cookedmode.destroytty_cookedmode.resume tty_quotemodetty_quotemode.destroytty_quotemode.resumetty_noquotemodetty_noquotemode.destroytty_noquotemode.resumetty_sttytty_stty.destroytty_stty.resume vi_paste_nextvi_paste_next.destroyvi_paste_next.resume vi_paste_prevvi_paste_prev.destroyvi_paste_prev.resumevi_prev_big_wordvi_prev_big_word.destroyvi_prev_big_word.resume vi_prev_wordvi_prev_word.destroyvi_prev_word.resumevi_next_big_wordvi_next_big_word.destroyvi_next_big_word.resume vi_next_wordvi_next_word.destroyvi_next_word.resumevi_change_casevi_change_case.destroyvi_change_case.resumevi_change_metavi_change_meta.destroyvi_change_meta.resumevi_insert_at_bolvi_insert_at_bol.destroyvi_insert_at_bol.resumevi_replace_charvi_replace_char.destroyvi_replace_char.resumevi_replace_modevi_replace_mode.destroyvi_replace_mode.resumevi_substitute_charvi_substitute_char.destroyvi_substitute_char.resumevi_substitute_linevi_substitute_line.destroyvi_substitute_line.resumevi_change_to_eolvi_change_to_eol.destroyvi_change_to_eol.resume vi_insertvi_insert.destroyvi_insert.resumevi_addvi_add.destroy vi_add.resume vi_add_at_eolvi_add_at_eol.destroyvi_add_at_eol.resumevi_delete_metavi_delete_meta.destroyvi_delete_meta.resumevi_end_big_wordvi_end_big_word.destroyvi_end_big_word.resume vi_end_wordvi_end_word.destroyvi_end_word.resumevi_undovi_command_modevi_zerovi_zero.destroyvi_zero.resumevi_delete_prev_charvi_delete_prev_char.destroyvi_delete_prev_char.resumevi_list_or_eofvi_list_or_eof.destroyvi_list_or_eof.resumevi_kill_line_prevvi_kill_line_prev.destroyvi_kill_line_prev.resumevi_search_prevvi_search_prev.destroyvi_search_prev.resumevi_search_nextvi_search_next.destroyvi_search_next.resumevi_repeat_search_nextvi_repeat_search_next.destroyvi_repeat_search_next.resumevi_repeat_search_prevvi_repeat_search_prev.destroyvi_repeat_search_prev.resume vi_next_charvi_next_char.destroyvi_next_char.resume vi_prev_charvi_prev_char.destroyvi_prev_char.resumevi_to_next_charvi_to_next_char.destroyvi_to_next_char.resumevi_to_prev_charvi_to_prev_char.destroyvi_to_prev_char.resumevi_repeat_next_charvi_repeat_next_char.destroyvi_repeat_next_char.resumevi_repeat_prev_charvi_repeat_prev_char.destroyvi_repeat_prev_char.resumevi_matchvi_match.destroyvi_match.resume vi_undo_linevi_undo_line.destroyvi_undo_line.resume vi_to_columnvi_to_column.destroyvi_to_column.resume vi_yank_endvi_yank_end.destroyvi_yank_end.resumevi_yankvi_yank.destroyvi_yank.resumevi_comment_outvi_comment_out.destroyvi_comment_out.resumevi_aliasvi_alias.destroyvi_alias.resumevi_to_history_linevi_to_history_line.destroyvi_to_history_line.resume vi_histeditvi_histedit.destroyvi_histedit.resumevi_history_wordvi_history_word.destroyvi_history_word.resumevi_redovi_redo.destroyvi_redo.resume reallocarrreallocarr.destroyreallocarr.resumewcsdupwcsdup.destroy wcsdup.resume tok_winittok_winit.destroytok_winit.resume tok_wresettok_wendtok_wend.destroytok_wend.resume tok_wlinetok_wline.destroytok_wline.resumetok_wstrtok_wstr.destroytok_wstr.resumetok_inittok_init.destroytok_init.resume tok_resettok_endtok_end.destroytok_end.resumetok_linetok_line.destroytok_line.resumetok_strtok_str.destroytok_str.resume history_winithistory_winit.destroyhistory_winit.resumehistory_def_nexthistory_def_firsthistory_def_lasthistory_def_prevhistory_def_currhistory_def_sethistory_def_set.destroyhistory_def_set.resumehistory_def_clearhistory_def_clear.destroyhistory_def_clear.resumehistory_def_enterhistory_def_enter.destroyhistory_def_enter.resumehistory_def_addhistory_def_add.destroyhistory_def_add.resumehistory_def_delhistory_def_del.destroyhistory_def_del.resume history_wendhistory_wend.destroyhistory_wend.resumehistory_save_fphistory_save_fp.destroyhistory_save_fp.resume history_inithistory_init.destroyhistory_init.resumehistory_def_next.720history_def_first.721history_def_last.722history_def_prev.723history_def_curr.724history_def_set.725history_def_set.725.destroyhistory_def_set.725.resumehistory_def_clear.726history_def_clear.726.destroyhistory_def_clear.726.resumehistory_def_enter.727history_def_enter.727.destroyhistory_def_enter.727.resumehistory_def_add.728history_def_add.728.destroyhistory_def_add.728.resumehistory_def_del.729history_def_del.729.destroyhistory_def_del.729.resume history_endhistory_end.destroyhistory_end.resumehistory_save_fp.750history_save_fp.750.destroyhistory_save_fp.750.resumefn_tilde_expandfn_tilde_expand.destroyfn_tilde_expand.resumefn_filename_completion_function'fn_filename_completion_function.destroy&fn_filename_completion_function.resumecompletion_matchescompletion_matches.destroycompletion_matches.resumefn_display_match_listfn_display_match_list.destroyfn_display_match_list.resumeappend_char_functionappend_char_function.destroyappend_char_function.resume_fn_qsort_string_compare _fn_qsort_string_compare.destroy_fn_qsort_string_compare.resume fn_complete2fn_complete2.destroyfn_complete2.resumeneeds_escaping fn_completefn_complete.destroyfn_complete.resume_el_fn_complete_el_fn_complete.destroy_el_fn_complete.resume_el_fn_sh_complete_el_fn_sh_complete.destroy_el_fn_sh_complete.resumerl_prep_terminalrl_prep_terminal.destroyrl_prep_terminal.resumerl_deprep_terminalrl_deprep_terminal.destroyrl_deprep_terminal.resume rl_set_promptrl_set_prompt.destroyrl_set_prompt.resumerl_save_promptrl_save_prompt.destroyrl_save_prompt.resumerl_restore_prompt rl_initializerl_initialize.destroyrl_initialize.resume _resize_fun_resize_fun.destroy_resize_fun.resume_getc_function_getc_function.destroy_getc_function.resume _get_prompt_el_rl_complete_el_rl_complete.destroy_el_rl_complete.resume _el_rl_tstp_el_rl_tstp.destroy_el_rl_tstp.resume rl_completerl_complete.destroyrl_complete.resume(_rl_completion_append_character_functionreadlinereadline.destroyreadline.resume_rl_event_read_char_rl_event_read_char.destroy_rl_event_read_char.resume using_historyusing_history.destroyusing_history.resumeget_history_eventget_history_event.destroyget_history_event.resume history_gethistory_get.destroyhistory_get.resumehistory_searchhistory_search.destroyhistory_search.resumehistory_search_prefixhistory_search_prefix.destroyhistory_search_prefix.resumehistory_expandhistory_expand.destroyhistory_expand.resumehistory_arg_extracthistory_arg_extract.destroyhistory_arg_extract.resumehistory_tokenizehistory_tokenize.destroyhistory_tokenize.resume add_historyadd_history.destroyadd_history.resumestifle_historystifle_history.destroystifle_history.resumeremove_historyremove_history.destroyremove_history.resumeunstifle_historyunstifle_history.destroyunstifle_history.resumehistory_is_stifledhistory_truncate_filehistory_truncate_file.destroyhistory_truncate_file.resume read_historyread_history.destroyread_history.resume write_historywrite_history.destroywrite_history.resumeappend_historyappend_history.destroyappend_history.resumereplace_history_entryreplace_history_entry.destroyreplace_history_entry.resume clear_historyclear_history.destroyclear_history.resume where_history history_listhistory_list.destroyhistory_list.resumecurrent_historycurrent_history.destroycurrent_history.resumehistory_total_byteshistory_total_bytes.destroyhistory_total_bytes.resumehistory_set_posprevious_historyprevious_history.destroyprevious_history.resume next_historynext_history.destroynext_history.resumehistory_search_poshistory_search_pos.destroyhistory_search_pos.resume tilde_expandtilde_expand.destroytilde_expand.resumefilename_completion_function$filename_completion_function.destroy#filename_completion_function.resumeusername_completion_function$username_completion_function.destroy#username_completion_function.resumerl_display_match_listrl_display_match_list.destroyrl_display_match_list.resume rl_bind_keyrl_bind_key.destroyrl_bind_key.resume rl_insertrl_insert.destroyrl_insert.resume rl_read_keyrl_read_key.destroyrl_read_key.resumerl_reset_terminalrl_reset_terminal.destroyrl_reset_terminal.resumerl_insert_textrl_insert_text.destroyrl_insert_text.resume rl_newlinerl_newline.destroyrl_newline.resume rl_add_defunrl_add_defun.destroyrl_add_defun.resumerl_bind_wrapperrl_bind_wrapper.destroyrl_bind_wrapper.resumerl_callback_read_charrl_callback_read_char.destroyrl_callback_read_char.resumerl_callback_handler_install#rl_callback_handler_install.destroy"rl_callback_handler_install.resumerl_callback_handler_remove"rl_callback_handler_remove.destroy !rl_callback_handler_remove.resume rl_redisplay rl_redisplay.destroy rl_redisplay.resume rl_forced_update_display rl_forced_update_display.destroy rl_forced_update_display.resume rl_get_previous_history rl_get_previous_history.destroy rl_get_previous_history.resume rl_read_init_file rl_read_init_file.destroy rl_read_init_file.resume rl_parse_and_bind rl_parse_and_bind.destroy rl_parse_and_bind.resume rl_variable_bind rl_variable_bind.destroy rl_variable_bind.resume rl_stuff_char rl_stuff_char.destroy rl_stuff_char.resume rl_copy_text rl_copy_text.destroy rl_copy_text.resume rl_replace_line rl_replace_line.destroy rl_replace_line.resume rl_delete_text rl_delete_text.destroy rl_delete_text.resume rl_get_screen_size rl_get_screen_size.destroy rl_get_screen_size.resume rl_set_screen_size rl_set_screen_size.destroy rl_set_screen_size.resume rl_completion_matches rl_completion_matches.destroy rl_completion_matches.resume rl_filename_completion_function 'rl_filename_completion_function.destroy &rl_filename_completion_function.resume _rl_abort_internal _rl_abort_internal.destroy _rl_abort_internal.resume _rl_qsort_string_compare _rl_qsort_string_compare.destroy _rl_qsort_string_compare.resume history_get_history_state !history_get_history_state.destroy history_get_history_state.resume rl_kill_text rl_make_bare_keymap rl_get_keymap rl_set_keymap rl_generic_bind rl_bind_key_in_map rl_set_key rl_cleanup_after_signal rl_on_new_line rl_free_line_state rl_set_keyboard_input_timeout rl_resize_terminal rl_resize_terminal.destroy rl_resize_terminal.resume rl_reset_after_signal rl_reset_after_signal.destroy rl_reset_after_signal.resume rl_echo_signal_char rl_echo_signal_char.destroy rl_echo_signal_char.resume rl_crlf rl_crlf.destroy rl_crlf.resume rl_ding rl_ding.destroy rl_ding.resume rl_abort rl_set_keymap_name free_history_entry _rl_erase_entire_line literal_init literal_init.destroy literal_init.resume literal_end literal_end.destroy literal_end.resume literal_clear literal_clear.destroy literal_clear.resume literal_add literal_add.destroy literal_add.resume literal_get literal_get.destroy literal_get.resume svis svis.destroy svis.resume istrsenvisx istrsenvisx.destroy istrsenvisx.resume do_svis do_svis.destroy do_svis.resume do_mvis do_mvis.destroy do_mvis.resume do_hvis do_hvis.destroy do_hvis.resume snvis snvis.destroy snvis.resume strsvis strsvis.destroy strsvis.resume strsnvis strsnvis.destroy strsnvis.resume strsvisx strsvisx.destroy strsvisx.resume strsnvisx strsnvisx.destroy strsnvisx.resume strsenvisx strsenvisx.destroy strsenvisx.resume vis vis.destroy vis.resume nvis nvis.destroy nvis.resume strvis strvis.destroy strvis.resume strnvis strnvis.destroy strnvis.resume stravis stravis.destroy stravis.resume strvisx strvisx.destroy strvisx.resume strnvisx strnvisx.destroy strnvisx.resume strenvisx strenvisx.destroy strenvisx.resume unvis unvis.destroy unvis.resume strnunvisx strnunvisx.destroy strnunvisx.resume strunvisx strunvisx.destroy strunvisx.resume strunvis strunvis.destroy strunvis.resume strnunvis strnunvis.destroy strnunvis.resume __ashlti3 __letf2 __getf2 __divti3 __divti3.destroy __divti3.resume __udivmodti4 __udivmodti4.destroy __udivmodti4.resume __modti3 __modti3.destroy __modti3.resume __udivti3 __udivti3.destroy __udivti3.resume __umodti3 __umodti3.destroy __umodti3.resume el_wset el_wset.destroy el_wset.resume el_wget el_wget.destroy el_wget.resume el_set el_set.destroy el_set.resume el_get el_get.destroy el_get.resume history_w history_w.destroy history_w.resume history history.destroy history.resume rl_message rl_message.destroy rl_message.resume __hwjs_drive_abi __hwjs_promise_i32 __hwjs_budget_not_refilled __hwjs_promise_i64 __hwjs_promise_a16 __hwjs_register_suspends __hwjs_suspends_register __hwjs_register_capsummary __hwjs_capsummary_register __hwjs_register_fpcast_adapter __hwjs_fpcast_register __hwjs_budget_set __hwjs_budget_get __hwjs_budget_uninitialized __hwjs_budget_sanity__stack_pointer __memory_base __table_base __hwjs_budgetmemcpyreallocmemsetwcschrcalloc free el_winsertstr wcslen el_deletestr el_deletestr1el_wreplacestrel_wgetcwcsncpywcsncmpel_initct_decode_stringwcsdupel_end el_init_fdel_reset el_source secure_getenvstrlensnprintffopenfclose __getdelim el_resize el_beep!wcscmp"fprintf#el_getc$wctob%el_push&el_wpush'el_gets(el_wgets)ct_encode_string*el_parse+ el_wparse,el_line- el_insertstr. el_replacestr/__isoc23_wcstol0 history_w1strvis2abort3malloc4wcstombs5wcrtomb6wctomb7mbstowcs8 tok_winit9tok_wstr:tok_wend;read<fcntl=el_wset>mbrtowc?wcsstr@regcompAregexecBregfreeCstrchrD sigactionEkillFgetenvGstrcmpHtgetentItgetflagJtgetnumKioctlLtgetstrMstrcpyNtgotoOtputsPfputsQfputcRfflushSstrlcpyT__isoc23_strtolUisattyV tcgetattrW tcsetattrXstrncmpY __assert_failZwcscspn[mkstemp\write]fork^close_execlp`exitaunlinkbwaitpidclseekd reallocarre tok_wlineftok_initgstrduphtok_enditok_linejtok_strk history_winitl history_wendmfchmodnftello history_initp history_endqfn_tilde_expandr getpwuid_rs getpwnam_rtfn_filename_completion_functionustrrchrvclosedirwopendirxreaddirycompletion_matcheszfn_display_match_list{qsort|stat} strcasecmp~ fn_complete2stdingetc fn_complete_el_fn_complete_el_fn_sh_completerl_prep_terminalel_setrl_deprep_terminal rl_set_prompt rl_promptmemmoverl_save_promptrl_prompt_saved rl_initializerl_readline_state rl_instream rl_outstreamstdoutrl_readline_namestderrhistorymax_input_historyhistory_lengthrl_line_bufferrl_getc_functionrl_catch_signalsrl_terminal_nameel_getrl_pointrl_endrl_already_prompted rl_completerl_inhibit_completionrl_completion_word_break_hookrl_basic_word_break_charactersrl_completion_entry_function rl_attempted_completion_functionrl_completion_query_itemsrl_attempted_completion_overrl_completion_typerl_completion_append_characterreadlinerl_startup_hookrl_donerl_pre_input_hook rl_event_hook using_historyhistory_offsetget_history_eventhistory_expansion_charhistory_search history_base history_getstrstrhistory_search_prefixhistory_expandhistory_subst_char"history_inhibit_expansion_functionhistory_no_expand_charshistory_arg_extracthistory_tokenize add_historystifle_historyremove_historyunstifle_historyhistory_truncate_filegetpwuidfdopenfreadferrorfwritefseekoftello ftruncate read_history write_historyappend_historyreplace_history_entry clear_history history_listcurrent_historyhistory_total_bytesprevious_history next_historyhistory_search_pos tilde_expandfilename_completion_functionusername_completion_functionsetpwentgetpwentendpwentrl_display_match_list rl_bind_key rl_insert rl_read_keyrl_reset_terminalrl_insert_text rl_newline rl_add_defunvisrl_callback_read_char rl_linefuncrl_callback_handler_installrl_callback_handler_remove rl_redisplayrl_forced_update_displayrl_get_previous_historyrl_read_init_filerl_parse_and_bindrl_variable_bind rl_stuff_char rl_copy_textrl_replace_linerl_delete_textrl_get_screen_sizerl_set_screen_sizerl_completion_matchesrl_filename_completion_function_rl_abort_internal_rl_qsort_string_comparestrcollhistory_get_history_staterl_resize_terminalrl_reset_after_signalrl_prep_term_functionrl_echo_signal_charrl_crlfrl_dingsvis mbsrtowcssnvisstrsvisstrsnvisstrsvisx strsnvisx strsenvisxnvisstrnvisstravisstrvisxstrnvisx strenvisxunvis strnunvisx strunvisxstrunvis strnunvisel_wget rl_message vsnprintf__hwjs_module_id __tls_base __hwjs_budget .rodata.data hwjs_reloc producerslanguageC11 processed-byclangf22.0.0git (git@gitlab.com:brintos/toolchain/llvm-project.git d408cdb5c577247eece58ef580d3e3bf53fbf516)target_features +atomics+ bulk-memory+bulk-memory-opt+call-indirect-overlong+ multivalue+mutable-globals+nontrapping-fptoint+reference-types+sign-ext